KEGG   Mycobacterium canettii CIPT 140070010: BN42_20242Help
Entry
BN42_20242        CDS       T02421                                 

Gene name
hemD
Definition
Putative uroporphyrin-III C-methyltransferase HemD (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mcx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
615436..617133
Genome map
AA seq 565 aa AA seqDB search
MTIMTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVLALIGTDL
PPVSGPAPAEPIAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGDPADVAKTLTAEAR
SGVDVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAATSAVPTYAGLPLGSSHTVA
DVRGDVDWDALAAAPGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQRSVE
TTLQGLTDPAVLGATDPACSANGRDPQAGPLIVTIGKTVTSRAKLNWWESRALYGWTVLV
PRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWIVFTSTNA
VRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPSGEQSSLGLLDDFPP
YDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATTREMIKTGG
FDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPDTAAIGPLVD
ALAEHAARLRAEGALPPPRKKSRRR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcatgacgcgagggcgtaagccgagaccgggccgcatcgttttcgtgggctcc
ggtccaggcgaccccggcttgcttacgacacgggctgcggcggtgctggccaacgccgcg
ctggtgttcaccgatcccgacgtaccggagccggtgctggcgctgatcggcacggatctg
ccccccgtgtccggaccggcgcccgccgagccgattgccgggaacggcgatgcggccggc
gggggaagtgcgcaggaacacggccgggccgcatccgcggtagtctccggtggtcctgac
atccgcccggcgctaggtgatcccgccgatgtggccaagacgctgaccgccgaggcccgt
tcgggtgtcgacgtggtgcggctggtggcgggcgatccgctcacggtggatgcggtaatc
agcgaggtaaacgccgtcgcacgcacccacctgcacatcgaaatcgtgcccggcctggcc
gccaccagcgcggtcccgacctatgccgggttgccgctgggttcgtcgcacaccgtcgcc
gacgtgcgcggcgatgtggactgggacgcgctggctgccgcacccgggccgctgatcctg
caggccaccgcatcgcatctagccgaatcggcccgcagcctgatcgatcaccagctggcc
gagtccactccgtgcgtggtgaccgcacacggcaccacctgccagcagcgttcggtcgag
accacacttcagggattgaccgacccggccgtcctgggcgctaccgaccccgcgtgctcc
gcaaacgggagggacccccaggccggaccgctgatagtgaccatcggcaagacggtgacc
agtcgggcaaagctgaactggtgggagagccgcgccctctacggctggacggtgttggtg
ccgcgcaccaaggaccaggccggtgagatgagcgagcggctcacgtcgtacggcgcgctg
ccggttgaggtgccgaccatcgccgtcgagccgccgcgcagccccgcgcagatggagcgc
gccgtcaagggcctggtcgatggccgattccagtggatcgtgttcacctccaccaacgcg
gtgcgtgcggtgtgggagaagttcggcgagttcggtctggatgcccgcgcgttctccggg
gtgaagatcgcctgtgtcggcgagtcgacggccgaccgggtgcgcgccttcggaatcagt
cccgagctggtgccctccggggagcagtcctcgcttggcttgctagacgacttcccgccc
tacgacagcgttttcgacccggtgaaccgggttttgctgccgcgcgccgacatcgccacc
gaaacgctggccgagggactgcgagagcgtggctgggagatcgaggacgtcaccgcctac
cggaccgtgcgggccgcgccgccgccggccaccacccgggaaatgatcaagacgggcggg
tttgacgcggtatgtttcacctccagctcgacggtgcgaaacctggtcggcatcgccggc
aagccgcacgcccggacgatcatcgcctgcatagggccaaagaccgccgagaccgccgcc
gagttcggcctgcgggtcgatgtccagccggacaccgccgccatcggcccgctggtcgat
gcgctggccgagcatgccgcccggttgcgcgctgagggtgcgctgcccccgccgcgcaag
aagagccgcaggcgctag

DBGET integrated database retrieval system