KEGG   Mycobacterium canettii CIPT 140070010: BN42_20371Help
Entry
BN42_20371        CDS       T02421                                 

Gene name
recD
Definition
(GenBank) Putative exonuclease V (alpha chain) RecD (exodeoxyribonuclease V alpha chain) (exodeoxyribonuclease V polypeptide)
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
mcx03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN42_20371 (recD)
Enzymes [BR:mcx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BN42_20371 (recD)
DNA repair and recombination proteins [BR:mcx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN42_20371 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD AAA_22 UvrD-helicase AAA_16 AAA_29 AAA_25 Herpes_Helicase AAA_28 Mg_chelatase T2SSE NTPase_1 TrwB_AAD_bind DEAD AAA_23 SRP54 UvrD_C MukB cobW ATPase PhoH
Motif
Other DBs
NCBI-ProteinID: CCK58645
Position
complement(736867..738594)
Genome map
AA seq 575 aa AA seqDB search
MTLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRA
GSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREE
EQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTI
ARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVT
LHRLLGAKPGARFRHDRQNRLPHTVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ
LASVEAGAVLADLVDGFSARDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSG
EERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPAGVL
RWNRRLQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPECLRAVVSG
ASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKR
KVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcaccgacgtcgattttgccgtcgaggcctccgggatggtgcgggccttcaac
caggccggtgtgctggacgtgtcggatgtgcatgtggcgcaacgtctctgtgcactggcc
ggggagagcgacgagcgggtggcgttggcggtagcggtggcggtccgcgcgctacgggcc
ggttcggtgtgtgtggatctgttgtcgatcgcgcgggtcgctggacacgacgacctgccg
tggccggatccggcggactggttggcggcggtgcgggccagtccgttgctcgccgatcca
cccgtgctgcacctatatgacgatcggctgctctatctggaccgctactggcgcgaagaa
gagcaggtgtgcgcggacctgctcgcgttgctgacatccaggcgaccggccggggtaccc
gacttgcggcgactgttcccgaccggctttgacgagcagcggcgcgcggcggaaatcgcg
ctctcgcaaggtgttacggtgttgaccggcgggcctggcaccgggaagacgacgacgatc
gcgcggctgctggcgttggttgccgagcaggcggagctggccggtgagccgcggccgcgg
atcgcgctggccgcacccaccggcaaggcggcggcccggctggccgaggcggtgcggcgc
gagatggccaagctcgacgccaccgaccgggcacggctcggcgacctgcacgcggtcacg
ctgcatcgtctgctgggtgccaaaccgggagcgcggtttcgccacgatcgccagaaccgg
ttgccccacaccgtgatcgtggtcgacgagacctcgatggtgtcgctgacgctgatggcc
cggctggccgaggcggtgcgcccgggcgcccggttgatcctcgtcggcgatgccgaccag
ttggcgtcggtggaagccggagcggtgctggccgatttggtcgatggcttctcggcgcgc
gacgacgcgctggtggcgcagctgcgaacgtcccatcggttcggcaaggtgatcggcacc
ttggccgaagcgatccgggccggcgatggcgacgccgtgctgggcctgctgcgatcgggt
gaggagcggatcgagttcgtcgacgacgaggatccggcgccgcggttgcgcgcggtgctg
gtgccacacgcgttgcggctgcgcgaggcggcgctgttgggtgcctccgacgtcgcgttg
gccaccctggacgagcaccggctgctgtgtgcgcatcgggacgggcccgccggcgtgctg
cgctggaaccgccggcttcaagcctggctcgccgaggagaccggccagccgccctggacg
ccgtggtacgccgggcgtccgctgctggtgacggccaacgactacggccttcgcgtctac
aacggcgacaccggtgtcgtgctggccggccccgagtgcctgcgggccgtcgtctctggt
gcatccgggccacttgacgttgccaccggccgcctcggcgacgtcgagaccatgcacgcg
atgactatccacaagagtcagggcagccaggtcgacgaggtgacggtgctgatgccgcaa
gaggattcgcggttgctgacccgggagttgctgtacaccgcggtgacccgggccaaacgc
aaggtccgggtggtcgggtccgaagcttcggtgcgggccgcgatcgcgcgccgggcggtg
cgggccagcgggttgcggatgcggttacagtcgacggggtgtggctga

DBGET integrated database retrieval system