KEGG   Mycobacterium canettii CIPT 140070010: BN42_20394Help
Entry
BN42_20394        CDS       T02421                                 

Definition
Putative glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN42_20394
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN42_20394
   00052 Galactose metabolism
    BN42_20394
   00500 Starch and sucrose metabolism
    BN42_20394
   00520 Amino sugar and nucleotide sugar metabolism
    BN42_20394
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN42_20394
   00524 Butirosin and neomycin biosynthesis
    BN42_20394
Enzymes [BR:mcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BN42_20394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
764336..765244
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKIAAGLADPAGALVHTAQRPTPAHGGAEQVWAAVAEMIADALAVAGGAV
GGVGIASAGPIDLRNGRVSPLNIGSWRGFPLRDRVVAAVPGVPVRLGGDGVCMALGEHWR
GAGRGARFLLGMVVSTGVGGGLVLDGAPYFGRTGNAGHVGHVVVDPDGSPCPCGGRGCVE
TIASGPSLARWARANGWSAAPGAGARQLAEAAGAGDPVALRAFGRGARALAAMIASVGAV
CDLDRVVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAA
MA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctctgcctggacatcggcggcaccaagatcgccgccggcctggccgacccc
gccggcgcgttggtgcacaccgcccaacgtcccaccccggcgcacggcggagccgaacag
gtctgggccgcggtcgccgagatgatcgccgacgcgctcgccgtggcggggggcgcggtg
ggtggtgtggggatcgcctcggccggtcctatcgacctgcgcaacggccgcgtcagccca
ctcaacatcggatcctggcgcgggtttccgctgcgggacagggttgtcgccgcggtgccg
ggggttccggtgcggctggggggtgacggggtgtgcatggcgctcggcgagcactggcgc
ggggcggggcggggtgcgcgtttcttgctgggcatggtggtgtccaccggggtgggcggc
gggttggtgctcgacggcgccccctacttcggccgcaccggcaatgccggtcacgtcggc
cacgtggtggtggatccggatggctcgccgtgcccgtgcggggggcgcggctgtgtggag
accatcgcgtccggtccgtcgctggcgcgctgggcgcgggccaacggctggtccgcggcg
cccggggccggcgccagacagctcgccgaggcggctggggccggagacccggtggcgctg
cgggccttcggccgcggcgccagggcgctggccgcgatgatcgcctcggtgggcgccgtg
tgcgacctggaccgcgtcgtcatcggcggcggcgtggccaagtcgggtcgcctgctgttc
gagccgttacgtgcggcgctagccgaccacgcccggctggactttctggccggcctgcgg
gtggtgcccgccgagctgggcggcgccgccggcctggtgggtgcggccaggctcgcggcc
atggcatga

DBGET integrated database retrieval system