KEGG   Mycobacterium canettii CIPT 140070010: BN42_20640Help
Entry
BN42_20640        CDS       T02421                                 

Gene name
fadB
Definition
(GenBank) Putative fatty acid oxidation protein FadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
mcx00071  Fatty acid degradation
mcx00280  Valine, leucine and isoleucine degradation
mcx00281  Geraniol degradation
mcx00310  Lysine degradation
mcx00362  Benzoate degradation
mcx00380  Tryptophan metabolism
mcx00410  beta-Alanine metabolism
mcx00640  Propanoate metabolism
mcx00650  Butanoate metabolism
mcx00903  Limonene and pinene degradation
mcx00930  Caprolactam degradation
mcx01040  Biosynthesis of unsaturated fatty acids
mcx01100  Metabolic pathways
mcx01110  Biosynthesis of secondary metabolites
mcx01120  Microbial metabolism in diverse environments
mcx01130  Biosynthesis of antibiotics
mcx01200  Carbon metabolism
mcx01212  Fatty acid metabolism
Module
mcx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN42_20640 (fadB)
   00650 Butanoate metabolism
    BN42_20640 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BN42_20640 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BN42_20640 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN42_20640 (fadB)
   00310 Lysine degradation
    BN42_20640 (fadB)
   00380 Tryptophan metabolism
    BN42_20640 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN42_20640 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN42_20640 (fadB)
   00281 Geraniol degradation
    BN42_20640 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN42_20640 (fadB)
   00930 Caprolactam degradation
    BN42_20640 (fadB)
Enzymes [BR:mcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN42_20640 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN42_20640 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN42_20640 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCK58884
Position
973343..975505
Genome map
AA seq 720 aa AA seqDB search
MVQNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASA
KKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAK
AKEIGLVDELVATVEELVPAAKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAA
ILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEA
AQKGKGYSEKLEAKALERGRTTPERSDALLARITPTADAADFKGVDFVIEAVFENQELKH
KVFQEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGS
QAGYPAPPLQLSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWPGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDENVLTSTA
DANIGSIMGIGFPPWTGGSAQFIVGYTGPAGTGKEAFVARARELAAAYGDRFLPPESLLS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaacacaattcagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gacgatccctccgggtcaaccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gccgtcgatcgccttgtcgccgaaaaggattcgatcaccggagtggtagtcgccagcgcg
aagaagaccttcttcgccggcggcgatgtcaagacgatgatccaggccaggcccgaggac
gccggcgatgtattcaacaccgtcgagaccatcaagcggcagctgcgcaccttggagaca
ctgggcaagccggtcgtcgcggccatcaacggggcggcgttgggcggcggcctggagatc
gcgctggcgtgtcatcaccggatcgccgccgacgttaagggcagccagctcggcctgccg
gaggtgacgctgggtctgttgccgggcggcggtggggtgacgcgcacggtgcggatgttc
ggcatccagaacgcgttcgtgagcgtgctggcgcaaggtacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgagctggtggcaacggtcgaggagctggtgcccgcc
gccaaggcctggataaaggaggagctcaaggccaacccggacggtgccggggtgcagccg
tgggacaagaagggctacaagatgcccggcggcaccccgtcgtcgccgggtctggcggcg
attttgccgtccttcccgtcgaacctgcgcaagcagctcaagggtgcgccgatgccggcg
ccgcgggccatcctggccgccgcggtcgagggggcacaggtcgacttcgacaccgccagc
cgcatcgagagccgctacttcgcgtcgttggtcaccggccaggtcgccaagaacatgatg
caggcgttcttcttcgacctgcaggccatcaatgccggcgggtctcggcccgaaggtatc
ggcaagaccccgatcaagaggatcggtgtgctgggtgcgggcatgatgggcgccggcatc
gcttacgtgtcggccaaggccggctatgaggtggtgctcaaagatgtcagcctcgaggcc
gcgcagaaaggcaagggctactccgaaaagctggaggccaaggcgctggagcggggtcgc
accacaccggagcgcagcgacgccctgctggcgcgcatcaccccgaccgccgacgccgcc
gatttcaagggcgtggacttcgtgatcgaggcggtctttgagaaccaggagctcaagcac
aaggtatttcaggagattgaggacatcgtcgagcccaacgcgatcctgggatccaacacc
tcgacgctgccgattaccggtctggccaccggcgtcaagcggcaggaagacttcatcggg
atccactttttctccccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acttccgacgaggccctggcccgggtgttcgactacaccttggccatcggcaagaccccg
atcgtggtcaacgacagccgcggctttttcacctcgcgggtcatcggcacgttcgtcaac
gaggcgctggcgatgcttggtgagggtgtcgagccggcttcgatcgagcaggcggggtcg
caggcgggttatccggcgccgccgttgcagctgtccgacgagctcaacctggagctgatg
cacaagatcgccgtcgccacccgtaagggtgttgaggacgctggcggcacgtaccagccg
catccggcggaggccgtggtggagaagatgatcgagctcggccggtccggccggctgaag
ggcgcgggcttctacgagtacgccgacggcaagcgatccgggttgtggcccggcttgcgc
gagacgttcaagtcgggctcgtcgcagccgccgctgcaggacatgatcgaccgcatgctg
ttcgccgaggcgctggaaacccagaagtgtctcgacgagaacgtgctgacgtcgacggcc
gatgccaacatcgggtccatcatgggcatcggcttcccgccgtggacgggtggcagtgcc
cagttcatcgtcggctacaccggcccggccggtacgggcaaggaagcctttgtggcccgg
gcccgcgagctggcggccgcctacggcgaccgcttcctgccgccggagtcgctgcttagc
tga

DBGET integrated database retrieval system