KEGG   Mycobacterium canettii CIPT 140070010: BN42_20773Help
Entry
BN42_20773        CDS       T02421                                 

Definition
Putative magnesium chelatase (EC:4.99.1.-)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN42_20773
Enzymes [BR:mcx01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BN42_20773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1111695..1113074
Genome map
AA seq 459 aa AA seqDB search
MSPRNLPRTVGELRAAGHRERGVKQEIRANLLTALAEGDDVWPGILGFDDTVIPQVERAL
IAGHDFVLLGERGQGKTRLLRALVGLLDEWTPVIAGAELGEHPYRPITPESIRRAAQLGD
DLPIAWKHRSERYTEKLATPDTSVADLIGDVDPIKVAEGRSLGDPETIAYGLIPRAHRGI
VAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPI
KDRFGAEIRTHYPLELEAEMGVIAQEAHLSAQVPDYLMQVLARFARYLRESRSIDQRSGV
SARFAIAAAETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGREQAVL
EHLLRRATVDTASRVLGGIDVGSLVTAVEGGSAVTTGERVSAKDVLAAVPGLPVVDRIAR
KLGAESEGERAAALELALEALYLAKRIDKVCGEGQTVYG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccagaaacctgccccgcaccgtgggcgagctgcgtgccgccggtcatcgggag
cggggggtcaagcaggaaatccgggcaaatctgctgaccgcgctggccgagggcgacgac
gtctggccgggcatcctgggtttcgacgacaccgtgattccccaggtggagcgggccttg
atcgccggtcacgatttcgttttgctcggcgaacgcggccagggcaagacccggctgctg
cgcgcgctggtcgggttgctcgacgagtggacgccggtgatcgccggcgccgaactgggt
gagcacccctaccggccgatcacgccggagtcgatccggcgggccgcgcagctcggcgac
gacctaccgatcgcgtggaagcatcgcagcgagcgctacaccgagaagctggccaccccg
gacaccagcgtcgccgacctgatcggcgacgtcgacccgatcaaggtcgccgagggccgc
agcctcggggatcccgaaaccatcgcctacgggctcatcccgcgggcgcaccgcggcatc
gtcgcggtcaacgagctgcccgacctcgccgaacgcattcaagtgtcgatgctcaacgtc
atggaagaacgcgacatccaggtccgcggctacacgctgcggctgccgctggatgtgttg
gtggtcgccagcgccaaccccgaggactacaccaaccgtggccgcatcatcacgcccatc
aaggaccggttcggcgccgagatccgcactcactacccgctggagctggaggcggagatg
ggcgtcatcgcccaggaggcgcacctgagtgcacaggtgcccgactacctgatgcaggtg
ctcgcgcggtttgcccgttacctgcgagaatcccgctcgatcgatcaacgctccggggtg
tcggcgcggttcgccatcgcggcggccgaaaccgtagcggccgccgcccggcaccgcggg
gcggtgctgggggagacggacccggtggcccgggtggtcgatttgggcacggtgatcgac
gtgctgcgcggcaagctggaattcgagtccggcgaggaagggcgcgaacaggcggtgctc
gagcatctgttgcgtcgcgccaccgtcgataccgcgtcccgggtgctgggcggtatcgac
gttggctcgttggtgaccgcggtcgagggcggttcggcggtgacgacgggggagcgggtg
tcggccaaggatgtgctggcggcggtgccgggcctgccggtggtggacaggatcgcgcgc
aagctgggcgccgaatccgagggggagcgggccgcggcactggaactggcgttggaggcg
ctatacctggccaagcgaatcgacaaggtctgcggggagggccagaccgtctatggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system