KEGG   Mycobacterium canettii CIPT 140070010: BN42_20918Help
Entry
BN42_20918        CDS       T02421                                 

Gene name
echA
Definition
Putative enoyl-CoA hydratase EchA8 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN42_20918 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN42_20918 (echA)
   00650 Butanoate metabolism
    BN42_20918 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN42_20918 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN42_20918 (echA)
   00310 Lysine degradation
    BN42_20918 (echA)
   00360 Phenylalanine metabolism
    BN42_20918 (echA)
   00380 Tryptophan metabolism
    BN42_20918 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN42_20918 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN42_20918 (echA)
   00281 Geraniol degradation
    BN42_20918 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN42_20918 (echA)
   00627 Aminobenzoate degradation
    BN42_20918 (echA)
   00930 Caprolactam degradation
    BN42_20918 (echA)
Enzymes [BR:mcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN42_20918 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1255117..1255890)
Genome map
AA seq 257 aa AA seqDB search
MTYETILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKA
FAAGADIKEMAGLTFADAFAADFFATWGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVV
PADDLLTEARATATTVSQMSASAARMAKEAVNRAFESSLSEGLLYERRLFHSAFATDDQS
EGMAAFIEKRAPQFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacgaaaccatcctggtcgagcgcgatcagcgagttggcattatcacgctgaac
cgtccccaggcactgaacgcgctcaacagccaggtgatgaacgaggtcaccagcgctgca
accgaactggacgatgacccggacattggggcgatcatcatcaccggttcggccaaagcg
tttgccgccggagccgacatcaaagaaatggccggcctgacgttcgccgacgcgttcgcc
gccgacttcttcgccacctggggcaagctggccgccgtgcgcaccccgacgatcgccgcg
gtggcgggatacgcgctcggcggtggctgcgagctggcgatgatgtgcgacgtgctgatc
gccgccgacaccgcgaagttcggacagcccgagataaagctgggcgtgctgccaggcatg
ggcggctcccagcggctgacccgggctatcggcaaggctaaggcgatggacctcatcctg
accgggcgcaccatggacgccgccgaggccgagcgcagcggtctggtttcacgggtggtg
ccggccgacgacttgctgaccgaagccagggccactgccacgaccgtttcgcagatgtcg
gcctcggcggcccggatggccaaggaggccgtcaaccgggctttcgaatccagtttgtcc
gaggggctgctctacgaacgccggcttttccattcggctttcgcgaccgacgaccaatcc
gaaggtatggcagcgttcatcgagaaacgcgctccccagttcacccaccgatga

DBGET integrated database retrieval system