KEGG   Mycobacterium canettii CIPT 140070010: BN42_20922Help
Entry
BN42_20922        CDS       T02421                                 

Gene name
fadA
Definition
(GenBank) Putative beta-ketoacyl CoA thiolase FadA3
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN42_20922 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BN42_20922 (fadA)
   00640 Propanoate metabolism
    BN42_20922 (fadA)
   00650 Butanoate metabolism
    BN42_20922 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN42_20922 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BN42_20922 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN42_20922 (fadA)
   00310 Lysine degradation
    BN42_20922 (fadA)
   00380 Tryptophan metabolism
    BN42_20922 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN42_20922 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN42_20922 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN42_20922 (fadA)
Enzymes [BR:mcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN42_20922 (fadA)
Exosome [BR:mcx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN42_20922 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1259003..1260220)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAMKGSLVGMRPDDLAVQMVRAALDKVPALNPHQIDDLMMGCGLP
GGESGFNIARVVAVALGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGDAFISAGVETV
SRFGKGNSDSWPDTKNPLFDGAQERSAAAAAGADEWHDPRADQKLPDIYIAMGQTAENVA
IMTGISREEQDTWGVRSQNRAEEAIKNGFFEREITPVTLPDGTTVSTDDGPRPGTTYEKV
SELKPAFRPNGTVTAGNACPLNDGAAAVVITSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEASKKALERAGMSITDIDLVEINEAFAVQVLGSARELGIDEDKLNVSGGAIALGH
PFGMTGARITTTLLNNLQTYDKTFGLETMCVGGGQGMAMVIERLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagctgtcatcgtctcgactgcccgctcgccgattggccgggccatgaaagga
tcgctggtcggcatgcggcccgacgacctggccgtccagatggtgcgcgccgcgctcgac
aaggttccggcactgaacccccatcagatcgacgacctcatgatgggctgtggcctgccg
ggcggtgagtccggtttcaacatcgcccgtgtcgtcgccgtcgcgctcggctatgacttc
ctgccgggcaccacggtcaaccggtactgttcgtcgtcgctgcagaccacccggatggcg
ttccacgcgatcaaggccggtgagggcgacgcgttcatctccgcgggcgtggaaaccgtc
tcccggttcggcaagggaaactccgactcctggccggacaccaagaacccgctgttcgac
ggggctcaggaacgttcggccgcggcagccgccggcgccgacgaatggcacgatccccgc
gccgatcagaagctgccggacatctatatcgcgatgggccagaccgcggaaaacgtcgcc
atcatgaccggcatcagccgcgaagaacaggacacctggggcgtgcgcagccagaaccgg
gccgaagaggcgatcaagaacgggttcttcgaacgagaaatcacgccggtcaccctcccg
gacggcaccacggtcagcaccgacgacggcccgcgaccgggtaccacctacgaaaaggtc
agcgagctcaagccggctttccggccgaacggcaccgtgaccgcggggaatgcctgtccg
ctcaacgacggggccgccgcggtggtgatcaccagcgacaccaaggccaaggaattaggc
ttgacaccgctggcgcgcattgtgtccaccggggtcagcgggctgtccccggagatcatg
ggcttagggccgatcgaggcgtccaagaaggcgctggaaagagccgggatgtcgatcacc
gacatcgacctggtcgagatcaacgaggccttcgcggtgcaggtcctgggctcggcgcgc
gagctgggcatcgacgaggacaagctcaacgtctcaggtggcgcgatcgccctaggtcac
ccgttcggtatgacgggcgcgcgcatcaccaccacgctgttgaacaacctgcagacctac
gacaagacgttcggtctggaaaccatgtgtgtcggcggcggccagggcatggcgatggtg
atcgagcgcctcgcgtga

DBGET integrated database retrieval system