KEGG   Mycobacterium canettii CIPT 140070010: BN42_21191Help
Entry
BN42_21191        CDS       T02421                                 

Gene name
thrC
Definition
Threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN42_21191 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN42_21191 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN42_21191 (thrC)
Enzymes [BR:mcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN42_21191 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1527265..1528347
Genome map
AA seq 360 aa AA seqDB search
MTVPPTATHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASA
ASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgccgacggccactcaccagccgtggccgggagtgattgccgcgtaccgt
gaccggctgccggtgggtgacgactggactccggtgactctgctcgagggtggtactccc
ctcatcgcggcaaccaatctctccaagcagacgggctgcacgatccacctcaaagtggag
ggcctcaaccccaccggctccttcaaggatcgtggcatgacgatggcggtcaccgatgcg
cttgcccatggtcagcgggcggtcttgtgcgcatcgaccggaaacacctcggcgtcggcg
gcggcctatgccgcccgggccggcatcacctgcgcggtgctgataccgcagggcaagatc
gcgatgggcaagctcgcacaggcggtcatgcacggcgccaagatcatccagatcgacggt
aacttcgacgactgcctggaactggcgcgcaagatggccgcggacttcccgacgatttcg
ttggtcaactcggttaacccggtgcgcatcgagggccagaaaacggcagcgttcgagatc
gtcgacgtgctaggtaccgcgccggacgtgcatgctctgccggttggcaacgccggcaac
atcaccgcgtactggaagggctacaccgagtatcaccagctgggcctgatcgacaagttg
ccccgcatgctaggcactcaggccgcgggcgcggcgcccctggtgctcggcgaaccggtg
agccacccggagaccatcgcaaccgcgatccgcatcggctcgccggcgtcgtggacttcg
gccgtcgaggcacagcagcagtccaagggccgcttcttggccgcctccgacgaggagata
ctggccgcataccacctggtggctcgtgtcgaaggcgtattcgtggagcccgcgtctgcg
gccagcatcgcgggtctcctcaaagcgatcgacgatggctgggtggcgcgtggctcgacg
gtggtgtgcacggtaaccggcaacggtcttaaggatcccgacaccgcgctcaaagacatg
ccgagcgtgtcaccggttcccgtggacccggtagccgtcgtcgagaagctagggctggcc
tag

DBGET integrated database retrieval system