KEGG   Mycobacterium canettii CIPT 140070010: BN42_21191Help
Entry
BN42_21191        CDS       T02421                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
mcx00260  Glycine, serine and threonine metabolism
mcx00750  Vitamin B6 metabolism
mcx01100  Metabolic pathways
mcx01110  Biosynthesis of secondary metabolites
mcx01120  Microbial metabolism in diverse environments
mcx01230  Biosynthesis of amino acids
Module
mcx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN42_21191 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN42_21191 (thrC)
Enzymes [BR:mcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN42_21191 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCK59365
Position
1527265..1528347
Genome map
AA seq 360 aa AA seqDB search
MTVPPTATHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASA
ASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgccgacggccactcaccagccgtggccgggagtgattgccgcgtaccgt
gaccggctgccggtgggtgacgactggactccggtgactctgctcgagggtggtactccc
ctcatcgcggcaaccaatctctccaagcagacgggctgcacgatccacctcaaagtggag
ggcctcaaccccaccggctccttcaaggatcgtggcatgacgatggcggtcaccgatgcg
cttgcccatggtcagcgggcggtcttgtgcgcatcgaccggaaacacctcggcgtcggcg
gcggcctatgccgcccgggccggcatcacctgcgcggtgctgataccgcagggcaagatc
gcgatgggcaagctcgcacaggcggtcatgcacggcgccaagatcatccagatcgacggt
aacttcgacgactgcctggaactggcgcgcaagatggccgcggacttcccgacgatttcg
ttggtcaactcggttaacccggtgcgcatcgagggccagaaaacggcagcgttcgagatc
gtcgacgtgctaggtaccgcgccggacgtgcatgctctgccggttggcaacgccggcaac
atcaccgcgtactggaagggctacaccgagtatcaccagctgggcctgatcgacaagttg
ccccgcatgctaggcactcaggccgcgggcgcggcgcccctggtgctcggcgaaccggtg
agccacccggagaccatcgcaaccgcgatccgcatcggctcgccggcgtcgtggacttcg
gccgtcgaggcacagcagcagtccaagggccgcttcttggccgcctccgacgaggagata
ctggccgcataccacctggtggctcgtgtcgaaggcgtattcgtggagcccgcgtctgcg
gccagcatcgcgggtctcctcaaagcgatcgacgatggctgggtggcgcgtggctcgacg
gtggtgtgcacggtaaccggcaacggtcttaaggatcccgacaccgcgctcaaagacatg
ccgagcgtgtcaccggttcccgtggacccggtagccgtcgtcgagaagctagggctggcc
tag

DBGET integrated database retrieval system