KEGG   Mycobacterium canettii CIPT 140070010: BN42_21294Help
Entry
BN42_21294        CDS       T02421                                 

Gene name
pyrB
Definition
Putative aspartate carbamoyltransferase PyrB (ATCase) (aspartate transcarbamylase) (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mcx00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mcx00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1627681..1628640
Genome map
AA seq 319 aa AA seqDB search
MTPRHLLTAADLSRDDATAILDDADRFAQALVGRDIKKLPTLRGRTVVTMFYENSTRTRV
SFEVAGKWMSADVINVSSAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLAQW
TGAHNDGPAVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRIVIVGDILHSRVARSNVM
LLDTLGAEVVLVAPPTLLPVGVTGWPATVSHDFDAELPAADAVLMLRVQAERMNGGFFPS
VREYSVRYGLTERRQAMLPGHAVVLHPGPMVRGMEITSSVADSSQSAVLQQVSNGVQVRM
AVLFHVLVGAQDAGKEGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaggcacctgctgaccgccgccgacctcagccgcgacgacgccaccgccatc
ctcgacgacgccgaccggtttgcgcaggcgctggtcggtcgcgacatcaagaagctgccg
acgctgcggggccggaccgtcgtcacgatgttctatgagaactccacccgcacccgggtg
tcgttcgaggtagcgggtaagtggatgagcgccgacgtgatcaacgtcagctccgccgga
tcttcggtaggcaagggtgagtcgctgcgggataccgcgctgaccctgcgcgcggccggg
gctgacgcgctgatcatccgccatcccgcgtccggcgccgcccatctgctggcgcagtgg
accggcgcccacaacgatgggccggcggtgatcaacgccggtgacggcactcatgaacac
cccacgcaggcgctgcttgatgcgctgaccatccgtcagcgcctcggcggcatcgaaggc
cggcgcatcgtgatcgtcggcgacatcctgcacagccgggtcgcccgctccaacgtcatg
ctgctggacaccctgggcgccgaggtggtgctggtggcgccacccacattgctaccggtc
ggggtgaccggctggccggccaccgtctcccacgacttcgatgccgagctgcccgccgcc
gacgcggtattgatgctgcgggtacaggccgagcggatgaacggcggttttttcccgtcc
gtacgggagtactcggtccgctacgggctaacagagcggcgccaggcgatgcttcccggc
cacgccgtggtgttgcacccgggaccgatggtgcgtggcatggagatcacatcttcggtc
gcggactcgtcgcaatcggctgtgctgcaacaggtttccaacggagtccaggtgcggatg
gcggtgctgttccatgtgctggtgggagcgcaggatgccggtaaagagggtgcggcgtga

DBGET integrated database retrieval system