KEGG   Mycobacterium canettii CIPT 140070010: BN42_30125Help
Entry
BN42_30125        CDS       T02421                                 

Gene name
adhA
Definition
Putative alcohol dehydrogenase AdhA (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BN42_30125 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN42_30125 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN42_30125 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BN42_30125 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN42_30125 (adhA)
   00626 Naphthalene degradation
    BN42_30125 (adhA)
Enzymes [BR:mcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN42_30125 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2192565..2193605
Genome map
AA seq 346 aa AA seqDB search
MVSPATMATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEG
DLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDLGDRVGIAWLRHTCGVCKYCRRGSE
NLCPESRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELP
PGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALELGAASAQDAADRPPVPL
DAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQRHLFQERQIRSVTSNTRA
DARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaccggcgaccatggcgacgatgagtgcgtggcaggtgcgtcggcccggcccg
atggacaccggcccgctcgaacgagtgaccacccgggtgccgcgcccggcgccatccgag
ttgctggtggccgtgcacgcatgcggggtgtgccgcaccgatcttcacgtgaccgaaggt
gacctgcccgtacaccgcgaacgggtgattcccggccacgaggtagtgggagaggtcatt
gaggtgggctcagcggtgggcgcggctgccggtggcgaattcgacctaggagaccgggtg
ggtatcgcctggctgcgtcacacttgcggggtctgcaagtactgccgacgcggcagcgag
aacctctgtccggaatcccgctacaccggctgggacgccgacgggggatacgccgaattc
acgacggttcctgcggctttcgcgcaccatctgccgagcggctatagcgacagcgagctg
gcgccgttgttgtgcgctggcatcatcggatatcgatcgctgctgcgcaccgagctacca
cccggtggccggctgggtctctacggattcggcggcagtgcccacatcaccgcccaggtc
gcgttggcgcaaggcgccgaaatacatgtgatgacacgcggggcccgcgcgcgcaagctg
gcgctggaacttggcgccgcatcggctcaggacgccgccgaccggccacccgtgccgctg
gacgccgcgatcttattcgccccggtcggggatctggtgctgcccgcgctggaagcgctg
gaccgtggcggcatcttggcgatcgccgggatccacctgaccgatattccggacctgaac
taccagcggcacttgttccaggagcgtcagatccggtcggtcacgtcgaacacccgcgcc
gatgcgcgcgcgttcttcgacttcgccgcccagcatcacatcgaggtcaccacgccggaa
tacccgcttggccaagccgatcgtgcgctgggcgacctgagcgccggccgcatcgccggc
gccgccgtgctgctgatctga

DBGET integrated database retrieval system