KEGG   Mycobacterium canettii CIPT 140070010: BN42_40133Help
Entry
BN42_40133        CDS       T02421                                 

Gene name
dlaT
Definition
DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN42_40133 (dlaT)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN42_40133 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    BN42_40133 (dlaT)
Enzymes [BR:mcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN42_40133 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2597605..2599278
Genome map
AA seq 557 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVTRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGGELARIGVAADIGAAPAPKPAPEPAPKPVPEPAPTPKAEPAPSPPAAQPAG
AAEGAPYVTPLVRKLASENNIDLAEVTGTGVGGRIRKQDVLAAAERKKRAKAPAPAAQAA
AAPAPKAPPAPAPALAHLRGTTQKASRIRQITADKTRESLQATAQLTQTHEVDMTKIVGL
RARAKAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVD
TEQGLLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFD
TPILVPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYLPLTYDHRLIDGADAGRFLT
TIKHRLEEGAFEADLGL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcccctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccgccaccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtgaccgaggggaccgtcactcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggccggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcggcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcacccgagcccgcacccaagcccgtccccgag
ccagcgccgacgccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggt
gcggccgagggcgcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaac
atcgacctcgccgaggtgaccggcaccggagtgggtggtcgcatccgtaaacaggatgtg
ctggccgcggctgagcgaaagaagcgggcgaaagcaccggcgccggccgcccaggccgcc
gccgcgccggccccgaaagcgccgcctgcccctgcgccggcgttggcgcatctacggggc
accacccagaaggccagccggattcgtcagatcaccgccgacaagacccgcgaatctttg
caggcaacggcacagctgacacaaacccatgaggtcgacatgaccaagatcgtggggcta
cgggcccgggccaaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccg
ttcttcgccaaggccgtgatcgatgccctcaagatccacccgaacatcaacgccagctac
aacgaggacaccaaggagatcacctactacgacgccgagcacctgggattcgctgtcgac
accgagcagggcctgctctccccggtcatccacgacgccggcgatctgtcactggccggt
ctggcgcgggcgatcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgac
gagttgtccggcggcaccttcaccatcaccaacatcggtagccagggcgcgttgttcgac
accccgatcctggttccgccgcaggccgccatgctgggcaccggggcgatcgtcaagcgg
ccgcgggtggtcgtcgatgccagcggcaacgagtcgatcggggtgcgctcggtctgctac
ctcccgttgacctatgaccatcggctcatcgacggcgccgacgccggacgtttcctcacc
acgatcaagcaccgcctcgaagagggagcgttcgaggccgacttaggactgtga

DBGET integrated database retrieval system