KEGG   Mycobacterium canettii CIPT 140070010: BN42_40384Help
Entry
BN42_40384        CDS       T02421                                 

Gene name
rbsK
Definition
Ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN42_40384 (rbsK)
Enzymes [BR:mcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BN42_40384 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2856978..2857859
Genome map
AA seq 293 aa AA seqDB search
MAPRVCVVGSVNIDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAAARAGAQVQFSG
AFGDDPAAAQLRAHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLVAPGANAHLTLV
PSAVANCDVLLTQLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSLQHLAAIADVVI
ANEHEADDWPSPPTHFVITQGVRGARYVGADGVFEVPAPTVTPVDTAGAGDVFAGVLAAN
WPGSPGSPAERLRALRRACAAGALATLVSGAGDCAPDAAAIDAALRANRHNGS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgggtgtgcgtggtaggcagcgtgaacatcgacctgacgttcgtggtggac
gcgcttccgcgccccggtgagacggtgcttgcggcgtcgttgacccgaacaccaggcggg
aagggcgccaaccaggcggtggccgcagcgcgcgcaggcgcgcaggtacagttctccggt
gcattcggcgacgatccagccgccgcccagctgcgggcccacctgcgcgccaacgccgtt
ggactggacaggaccgtcacggtgcccggaccgagcgggacggcgattatcgtggtcgac
gccagcgccgaaaacaccgtgctggtggcaccgggtgccaatgcacatctgactctggta
ccctcggccgtcgccaactgcgatgtactgttgacccagttggagattcccgttgcaacc
gcgctggcagccgcgcgggcagcccagtcggccgatgcggttgtcatggtcaacgcctcc
ccagccggccaggatcgaagctccttgcagcacttggcagctatcgccgacgtggtgatc
gccaacgagcatgaggcagacgactggccgtcgccaccaacacatttcgtgatcacccag
ggtgtgcgcggtgcccggtacgtcggcgcggacggggtgttcgaggtacccgccccaacg
gtgacgccagtggataccgccggcgccggcgacgtatttgccggggtccttgctgcgaat
tggccgggcagcccaggttcaccggccgagcgactgcgcgcattgcggcgcgcctgcgct
gcgggtgcgctggcaaccttggtgtccggtgccggcgactgcgcaccggacgccgccgcg
atcgatgcggccctgcgagccaaccgccacaacggttcatga

DBGET integrated database retrieval system