KEGG   Mycobacterium canettii CIPT 140070010: BN42_40450Help
Entry
BN42_40450        CDS       T02421                                 

Gene name
pdhC
Definition
Putative dihydrolipoamide S-acetyltransferase E2 component PdhC (lipoate acetyltransferase) (thioltransacetylase A) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mcx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcx00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mcx00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mcx00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2932632..2933813)
Genome map
AA seq 393 aa AA seqDB search
MSGEDSIRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGR
IVELGCAEGDVLKVGAELVRIDTGLTAVAQPNGEGAVPTLVGYGADAAIETSRRPSRPLA
APVVRKLAKELAVDLAALQRGSGGGGVITRADVLAAARGGVGAGPDVRPVHGVHARMAEK
MTLSHKEIPTAKASVEVICAELLRLRDRFVSAAPEITPFVLTLRLLVIALKHNVILNSTW
VDSAEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQDKNTRELASRVAELITGARAGTLT
PAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPRPVVVGGEVVARPTMRLTC
VFDHRVVDGAQVAQFMCELRDLIESPETALLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaggacagcatcaggtctttcccggtgcccgacctcggcgagggactgcag
gaagtgacggtgacgtgctggagcgtcgccgtcggcgacgatgtggagatcaaccagacg
ctgtgttcggtggagaccgccaaggccgaggttgaaatccccagcccgtatgccggccgg
atcgtcgagttaggctgcgccgaaggcgatgtgctcaaagtgggcgcggagctagttcgg
atcgacaccgggctcacggcagttgcgcagcctaacggtgagggagcggtccccacgttg
gtcggctacggtgccgacgccgcgatcgaaaccagtagacggccaagccggccgctggcg
gcaccggtagtgcgcaagctggccaaagagttggcggtcgacctggccgcattgcagcgt
gggtcgggcggcggcggtgtgatcacccgggccgatgtgctggccgctgctcgaggtggc
gtcggagccgggccagacgtgcgaccggtccacggcgtgcacgcgcggatggccgaaaaa
atgacgttgtcccacaaggagattccgaccgcaaaggccagcgttgaggtaatttgcgcc
gaactgctgcggctgcgcgaccggttcgtttcggcggcgcccgagattacgccgttcgtg
ctgacgctgcggctgctggttattgcattgaaacacaacgtaattctcaactcgacgtgg
gtcgactcggcggaaggcccgcaagtacacgtgcatcgcggtgtgcatctggggttcggc
gcggccactgagcgtggattgctggtgccggtggtgaccgacgcccaggacaagaacacc
cgcgaacttgcctcccgcgtagcggaattaatcaccggtgcacgtgcaggcactctcaca
cccgctgagctgcgcggttcgacgttcacggtgtcgaacttcggggcgctgggagtcgac
gacggtgtgccggtgatcaaccatcccgaagcggcgatcctgggtctgggggcgatcaag
ccgcgcccggtggtcgtcggcggcgaggttgtcgcacggccgacgatgaggttgacttgt
gtgttcgaccaccgcgttgtcgatggtgctcaggtggcccagttcatgtgtgagctgcgg
gatctgatcgagtcgccggagaccgcgctgttggatctgtag

DBGET integrated database retrieval system