KEGG   Mycobacterium canettii CIPT 140070010: BN42_40717Help
Entry
BN42_40717        CDS       T02421                                 

Gene name
ephG
Definition
Epoxide hydrolase (EC:3.3.2.8)
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN42_40717 (ephG)
Enzymes [BR:mcx01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     BN42_40717 (ephG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3175146..3175595
Genome map
AA seq 149 aa AA seqDB search
MAELTETSPETPETTENIRAVEEFLNALQDEDFDTVDAALGDDLVYENVGFSTIRGGRRT
AKLLRRMQGRIGFEVKIHRIGADGAAVLTERTDALIFGPLRVQFWVCGVFEVHDGRITLW
RDYFDVYDMLKGLLRGLVALVVPSLKATL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaccgagacatcgccggaaacccccgaaaccaccgagaacattcgtgcc
gtcgaggagttcctcaacgccctgcaggacgaagacttcgacaccgtcgacgccgcactg
ggcgacgacctggtctatgagaacgtcgggttttccacgatccgcggtggccgccgcacg
gcgaagctgttgcgccggatgcaaggccgcatcgggttcgaggtaaagattcaccgcatc
ggcgccgacggcgccgcggtgctcaccgaacgcaccgacgcactaatctttggcccgctg
cgggtgcagttctgggtctgcggcgtattcgaggtgcacgacgggcggatcaccctgtgg
cgggactacttcgatgtctatgacatgctcaagggcctcttgcgaggcctggtggcgctg
gtggtgccatcgctgaaggcaacactatag

DBGET integrated database retrieval system