KEGG   Mycobacterium canettii CIPT 140070010: BN42_41035Help
Entry
BN42_41035        CDS       T02421                                 

Definition
Alpha (1->4) glucosyltransferase (EC:2.-.-.-)
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN42_41035
Enzymes [BR:mcx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     BN42_41035
Glycosyltransferases [BR:mcx01003]
 Polysaccharide
  Storage polysaccharide
   BN42_41035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3514141..3515385
Genome map
AA seq 414 aa AA seqDB search
MRILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEG
VRVIAAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKRGTDRSWRPDIVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMND
EITELFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPR
LRRTHPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPA
AAQRRARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcctcatggtgtcgtgggagtacccgccggtggtgatcggcggactcggccgc
cacgtgcatcatctgtcgaccgcgctagccgcagccggtcacgatgtcgtcgtgttgtcc
cggtgtccgtcgggcaccgatcccagcacacacccatcctccgatgaggtgaccgaaggg
gtccgggtgattgcggccgcgcaggacccgcacgagttcacgttcggcaacgacatgatg
gcctggaccctggcgatgggccacgccatgatccgcgccgggctgcgcttaaagaaacgt
ggcaccgaccgctcgtggcgtcctgacatcgtgcacgcacacgactggctggtggcccat
ccggcgatcgcccttgcccagttctatgacgtgccaatggtttccacgattcatgcaacg
gaagccggtcgacattccggttgggtctccggagctctcagccgtcaggtgcacgcggtc
gagtcgtggctggtgcgtgaatccgattcgctgatcacatgctcggcgtcgatgaacgac
gagatcaccgagctgttcgggcccgggctggccgagatcaccgtgatccgtaacggcatt
gacgcggcgcgctggccgttcgcggcccgccgcccgcgcaccgggccagccgaattgctc
tatgtggggcggctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcgg
ctcaggcgcactcacccaggcaccacactgaccatcgccggcgaaggcacccagcaggat
tggctgatcgatcaggcccgcaaacaccgggtgctcagagcaaccaggttcgtcggacac
ctcgaccacaccgagctgctggcgttgctgcaccgagccgacgccgcggtgctgcccagc
cactacgaaccgtttgggctggtggcactggaggccgccgcggccggcaccccgctggtg
acgtccaacatcggcggtctgggtgaagcggtcatcaatggacagaccggggtgtcgtgt
gcaccccgcgacgtagcggggctggccgccgcggtgcgtagcgtgctcgacgatccggcc
gccgcgcagcggcgcgcacgagccgcccggcaacggctcacctccgacttcgactggcag
acggtggccaccgcgaccgcgcaggtgtacctggcggccaaacgcggtgaacggcagccg
cagccccggttgcccatcgtcgagcacgctcttcctgaccgctag

DBGET integrated database retrieval system