KEGG   Mycobacterium canettii CIPT 140070010: BN42_41313Help
Entry
BN42_41313        CDS       T02421                                 

Gene name
fbiB
Definition
Putative F420 biosynthesis protein FbiB (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mcx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3779556..3780902
Genome map
AA seq 448 aa AA seqDB search
MTGPEHGSASTIEILPVIGLPEFRPGDDLSAAVAAAAPWLRDGDVVVVTSKVVSKCEGRL
VPAPEDPEQRDRLRRKLIEDEAVRVLARKDRTLITENRLGLVQAAAGVDGSNVGRSELAL
LPVDPDASAATLRAGLRERLGVTVAVVITDTMGRAWRNGQTDAAVGAAGLAVLRNYAGVR
DPYGNELVVTEVAVADEIAAAADLVKGKLTATPVAVVRGFGVSDDGSTARQLLRPGANDL
FWLGTAEALELGRQQAQLLRRSVRRFSTDPVPGDLVEAAVAEALTAPAPHHTRPTRFVWL
QTPAIRARLLDRMKDKWRSDLTSDGLPADAIERRVARGQILYDAPEVVIPMLVPDGAHSY
PDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWIGSTIFAADLVRDELDLPVDWEP
LGAIAIGYADEPSGLRDPVSAADLLIRK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggccccgaacatggctccgcctcgaccatcgagatcctgcccgtcatcgggctg
cccgaattccgtcccggcgacgatctgagcgccgccgtcgccgcggcggcaccgtggcta
cgcgacggtgacgtcgtggtggttaccagcaaggtggtgtctaaatgcgagggtcggctg
gttccggctcccgaagaccccgagcaaagagaccgattgcgccgcaagctgatcgaggat
gaggcagtgcgcgtgttagcgcgcaaggaccgcacgttgatcaccgagaatcgactcggg
ctggttcaggcggccgccggcgtggacggatccaacgtcggccggtccgagttagcgctg
ctgccggtcgatcccgacgccagtgccgcaaccttgcgcgccgggctgcgcgagcggctc
ggcgtcaccgtcgccgtggtcatcaccgacaccatgggacgcgcctggcgcaacggccag
accgatgccgcagtcggcgctgccggtctggcggtgctgcgcaactatgccggtgtccgc
gacccatacggcaatgagttggtggtcaccgaggtcgcagtcgccgacgagatcgccgcg
gccgccgacttggtcaaaggcaaactgaccgcgacgccggtggcggtggtgcgtgggttc
ggcgtgtccgacgacggctcgacagcccggcaactgctgcggccgggcgccaacgacctg
ttctggctcgggaccgccgaagcgctcgagctgggtcgccagcaagcccaactgttgcgc
aggtccgttcgccggtttagcaccgatccggtgccgggcgacctcgtcgaggctgcggtc
gccgaggccctcaccgcgccagccccacatcacacccggccgacccgattcgtgtggctg
cagacaccggccatccgcgcgcggctgctagaccggatgaaagacaagtggcggtctgat
ctcaccagtgacggcttgcccgccgacgcgatagaacgccgggtggcacgcggccagatc
ctctatgacgcacccgaagtcgtcataccgatgctggtgcccgacggagcacacagctac
cccgatgccgcccgcaccgacgccgagcacaccatgttcacggtcgccgtcggagcggcc
gtacaagccttgctggtcgcgctggccgtgcgcgggctgggcagttgctggatcggctcg
acgatctttgccgctgacctggtccgcgacgagctggacctgccagtcgactgggagccg
ttgggcgccatcgcgatcggatatgccgacgagccgtccgggttgcgcgacccggtgtct
gccgccgatttgctgatccgcaagtga

DBGET integrated database retrieval system