KEGG   Mycobacterium canettii CIPT 140070010: BN42_41378Help
Entry
BN42_41378        CDS       T02421                                 

Gene name
sdhD
Definition
(GenBank) Putative succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD (Succinic dehydrogenase) (Fumarate reductase) (Fumarate dehydrogenase) (Fumaric hydrogenase)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
mcx00020  Citrate cycle (TCA cycle)
mcx00190  Oxidative phosphorylation
mcx00650  Butanoate metabolism
mcx01100  Metabolic pathways
mcx01110  Biosynthesis of secondary metabolites
mcx01120  Microbial metabolism in diverse environments
mcx01130  Biosynthesis of antibiotics
mcx01200  Carbon metabolism
Module
mcx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN42_41378 (sdhD)
   00650 Butanoate metabolism
    BN42_41378 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BN42_41378 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF5345
Motif
Other DBs
NCBI-ProteinID: CCK61446
Position
3846206..3846640
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVALVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggcgttgcgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgctgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system