KEGG   Mycobacterium canettii CIPT 140070010: BN42_41378Help
Entry
BN42_41378        CDS       T02421                                 

Gene name
sdhD
Definition
Putative succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD (Succinic dehydrogenase) (Fumarate reductase) (Fumarate dehydrogenase) (Fumaric hydrogenase) (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN42_41378 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN42_41378 (sdhD)
   00650 Butanoate metabolism
    BN42_41378 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BN42_41378 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3846206..3846640
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVALVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggcgttgcgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgctgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system