KEGG   Mycobacterium canettii CIPT 140070010: BN42_90045Help
Entry
BN42_90045        CDS       T02421                                 

Definition
Putative Enoyl-CoA Hydratase EchA20 (Enoyl Hydrase) (Unsaturated Acyl-CoA Hydratase) (Crotonase) (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN42_90045
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN42_90045
   00650 Butanoate metabolism
    BN42_90045
  Lipid metabolism
   00071 Fatty acid degradation
    BN42_90045
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN42_90045
   00310 Lysine degradation
    BN42_90045
   00360 Phenylalanine metabolism
    BN42_90045
   00380 Tryptophan metabolism
    BN42_90045
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN42_90045
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN42_90045
   00281 Geraniol degradation
    BN42_90045
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN42_90045
   00627 Aminobenzoate degradation
    BN42_90045
   00930 Caprolactam degradation
    BN42_90045
Enzymes [BR:mcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN42_90045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4100671..4101414
Genome map
AA seq 247 aa AA seqDB search
MPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGADLDTRVVILRAEGRGFNA
GVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNSDVIV
ASEDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAATLQHFGSVHEVVPRD
QLDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNASYRMEQGFTFELNLAGVADEHR
DAFVKKS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcacctccaccacgcccgaaccgggcatcgtcgcggtcaccgtcgactacccg
ccggtcaacgccatcccgtcgaaagcgtggttcgacctggccgacgcggtgacggccgcc
ggcgccgatctcgacacccgcgtggtgatcctgcgggccgagggtcgcggcttcaacgcc
ggggtggacatcaaagagatgcaacgaaccgaaggcttcacggcgctgatcgacgccaac
cgcggctgcttcgccgcctttcgcgccgtctacgagtgcgcggtgccggtgatcgccgcg
gtgaacggattctgcgtcggcggcggcatcggcctggtcggcaactccgacgtcatcgtg
gcctccgaggacgccacgttcggcctgcccgaggtggaacggggtgcgctgggcgcggcc
acccacctctcgcggctggtgccccagcacctgatgcggcggctgttcttcacggcggcc
accgtggacgcggcgaccttgcagcatttcggctcggtgcacgaggtggttccccgcgat
cagctggacgaggccgctttgcgggtggcccgcgacatcgccgccaaagacactcgggtc
attcgcgcggccaaggaggcgctgaacttcatcgacgtgcaacgggtcaatgcgagttac
cggatggagcaaggttttaccttcgagctcaacctcgccggtgtggccgacgagcaccgc
gacgcctttgtgaagaagtcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system