KEGG   Mycoplasma cynos: MCYN_0066Help
Entry
MCYN_0066         CDS       T02424                                 

Gene name
MCYN0066
Definition
ROK family hexose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mcy  Mycoplasma cynos
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCYN_0066 (MCYN0066)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCYN_0066 (MCYN0066)
   00052 Galactose metabolism
    MCYN_0066 (MCYN0066)
   00500 Starch and sucrose metabolism
    MCYN_0066 (MCYN0066)
   00520 Amino sugar and nucleotide sugar metabolism
    MCYN_0066 (MCYN0066)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCYN_0066 (MCYN0066)
   00524 Butirosin and neomycin biosynthesis
    MCYN_0066 (MCYN0066)
Enzymes [BR:mcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MCYN_0066 (MCYN0066)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(63801..64715)
Genome map
AA seq 304 aa AA seqDB search
MDWKNKNNSYAAVDVGGTNVRFAIFDENGKIISKVKTSTDYTSAENTCNWIKEWILENNI
MYLALCIPGPSDYENGIVLNSPNLGGTWKNFDVKQYLLKNTQIKDIVFENDANVMALANH
VYYKKNLNDVSQFYTISTGFGSGLIINNKIFHGNNYYAQEIAQIPVSKSAFLGKSRLLNK
YALELHCSGSGIETKAKYYDIANSAKEVFELAEKGNIQATKIVNEAKETLMNMFAINAGI
IAPHNFFIGGSVALAQKQFVIDAFNLAKEISDPNHFKNINLYFDELGDDSALYGLYNLIK
LRNG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggactgaaaaaataaaaacaactcttatgcggctgttgatgttggcggtacaaatgtc
cgttttgcaatttttgatgaaaatggaaaaataatatcaaaagtaaaaacatcaactgat
tatacatcagccgaaaatacttgtaattgaatcaaagaatgaattttagaaaataatatt
atgtatctggcactttgcataccaggaccaagtgattatgaaaatggaattgtacttaat
agtcctaatttaggtggcacttgaaaaaactttgatgttaaacaatatcttttaaaaaat
actcaaataaaagatattgtttttgaaaatgacgcaaatgtaatggctttggctaatcat
gtttattacaaaaaaaatttaaatgatgtaagtcaattttatacaataagcactggtttt
ggttcaggtttaataataaataataaaatctttcacggaaacaattattatgcccaagaa
atcgcgcaaattcctgtctctaaatctgcttttttagggaaaagtagattattaaataaa
tatgcgcttgaacttcattgttcaggcagtgggatagaaacaaaagctaaatattatgat
attgctaattcagcaaaagaagttttcgaattagctgaaaaaggaaatatacaagcaact
aaaattgttaatgaagcaaaagaaacattaatgaatatgtttgcaattaatgcaggaatt
attgctccacataatttctttattggtggaagtgtagcattagctcaaaaacaatttgtt
attgatgcgtttaatttagcaaaagaaattagcgatccaaatcattttaaaaacattaat
ttatattttgatgaattaggagacgattccgcattatatggtctttacaatcttatcaaa
ttaagaaatggataa

DBGET integrated database retrieval system