KEGG   Mycoplasma cynos: MCYN_0066Help
Entry
MCYN_0066         CDS       T02424                                 

Gene name
MCYN0066
Definition
(RefSeq) ROK family hexose kinase
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mcy  Mycoplasma cynos
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCYN_0066 (MCYN0066)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCYN_0066 (MCYN0066)
   00052 Galactose metabolism
    MCYN_0066 (MCYN0066)
   00500 Starch and sucrose metabolism
    MCYN_0066 (MCYN0066)
   00520 Amino sugar and nucleotide sugar metabolism
    MCYN_0066 (MCYN0066)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCYN_0066 (MCYN0066)
   00524 Butirosin and neomycin biosynthesis
    MCYN_0066 (MCYN0066)
Enzymes [BR:mcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MCYN_0066 (MCYN0066)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(63801..64715)
Genome map
AA seq 304 aa AA seqDB search
MDWKNKNNSYAAVDVGGTNVRFAIFDENGKIISKVKTSTDYTSAENTCNWIKEWILENNI
MYLALCIPGPSDYENGIVLNSPNLGGTWKNFDVKQYLLKNTQIKDIVFENDANVMALANH
VYYKKNLNDVSQFYTISTGFGSGLIINNKIFHGNNYYAQEIAQIPVSKSAFLGKSRLLNK
YALELHCSGSGIETKAKYYDIANSAKEVFELAEKGNIQATKIVNEAKETLMNMFAINAGI
IAPHNFFIGGSVALAQKQFVIDAFNLAKEISDPNHFKNINLYFDELGDDSALYGLYNLIK
LRNG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggactgaaaaaataaaaacaactcttatgcggctgttgatgttggcggtacaaatgtc
cgttttgcaatttttgatgaaaatggaaaaataatatcaaaagtaaaaacatcaactgat
tatacatcagccgaaaatacttgtaattgaatcaaagaatgaattttagaaaataatatt
atgtatctggcactttgcataccaggaccaagtgattatgaaaatggaattgtacttaat
agtcctaatttaggtggcacttgaaaaaactttgatgttaaacaatatcttttaaaaaat
actcaaataaaagatattgtttttgaaaatgacgcaaatgtaatggctttggctaatcat
gtttattacaaaaaaaatttaaatgatgtaagtcaattttatacaataagcactggtttt
ggttcaggtttaataataaataataaaatctttcacggaaacaattattatgcccaagaa
atcgcgcaaattcctgtctctaaatctgcttttttagggaaaagtagattattaaataaa
tatgcgcttgaacttcattgttcaggcagtgggatagaaacaaaagctaaatattatgat
attgctaattcagcaaaagaagttttcgaattagctgaaaaaggaaatatacaagcaact
aaaattgttaatgaagcaaaagaaacattaatgaatatgtttgcaattaatgcaggaatt
attgctccacataatttctttattggtggaagtgtagcattagctcaaaaacaatttgtt
attgatgcgtttaatttagcaaaagaaattagcgatccaaatcattttaaaaacattaat
ttatattttgatgaattaggagacgattccgcattatatggtctttacaatcttatcaaa
ttaagaaatggataa

DBGET integrated database retrieval system