KEGG   Mycoplasma cynos: MCYN_0335Help
Entry
MCYN_0335         CDS       T02424                                 

Gene name
MCYN0335
Definition
Holliday junction ATP-dependent DNA helicase ruvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mcy  Mycoplasma cynos
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCYN_0335 (MCYN0335)
Enzymes [BR:mcy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MCYN_0335 (MCYN0335)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340020..340700
Genome map
AA seq 226 aa AA seqDB search
MIAKYIMFCYFYSFFSSYYFCIYHYNGGKMILYKIGEIVYKNKNNIIFENKGDGYIVNVA
NVDRFEVGAKCKIFLYEYNTEFYKNIYGFKDFKERLLFTDLITIDKIGPRVAMIILEKGW
ELVANYIINDNWQELSKINFVSEKTAKFICVELKNKWTKLIDNNAKKDSKDLNNISELSS
TLSTLGFKKNQIDFAIKNVKEQKDLDKMIEESISLIANNKDATYRT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatagcaaaatatataatgttttgctatttttattccttttttagttcatattatttt
tgtatatatcattacaatggagggaaaatgatattatacaaaattggcgagattgtttat
aagaataaaaacaatattatattcgaaaacaaaggcgatggatatattgtaaatgtcgcg
aatgttgatagatttgaggttggtgcaaaatgcaaaatatttttatatgagtacaacact
gagttttataaaaatatttatggatttaaagattttaaggaaaggttattatttactgac
ttaatcactattgataagataggtccgagagttgcgatgataattcttgaaaaaggttga
gaattagttgcaaattatattattaatgataattggcaggaattatctaaaattaatttt
gtttctgagaagactgcaaaatttatctgtgtggaactgaaaaataagtgaactaaatta
attgataataatgcaaaaaaagattcaaaagatttaaataatataagtgaattatcatca
acattaagtacattaggttttaaaaagaatcaaatagattttgcaataaaaaatgtcaaa
gagcaaaaagacttagacaaaatgattgaagagagtatatctctaatcgctaataataaa
gatgcaacttacagaacttag

DBGET integrated database retrieval system