KEGG   Mycoplasma cynos: MCYN_0522Help
Entry
MCYN_0522         CDS       T02424                                 

Gene name
MCYN0522
Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mcy  Mycoplasma cynos
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MCYN_0522 (MCYN0522)
Enzymes [BR:mcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MCYN_0522 (MCYN0522)
Exosome [BR:mcy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCYN_0522 (MCYN0522)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(553969..555492)
Genome map
AA seq 507 aa AA seqDB search
MKDKFVITLDSGTTSCRTLVVNHDGEIVASSQTEFTQYFPRSGWVEHDPLEIWNTQLSTM
QSAKHKAKIKSHDIAALGITNQRETIVLWDKETGLPVYNAIVWQDRRTSDYCDELVKAGW
TEKITEKTGLIINPYFSGTKIRWILKNVPEAQMKFKEGKLLAGTIDTWLMWKLTDAKVHA
TDVSNASRTMLFNIHTLDWDQEILDLLEIPREILPEVKSSSEYYGYVKPTHWSNKAVGEV
PITGVAGDQQSALFGQMCTEVGMVKNTYGTGCFTLVNTGTTPVKSKNKLLTTIAWKLGKE
KTVYALEGSVFIAGAAIKWLRDSIRIIYDSAESDFFTSLVDDDQKQRVYVVPSFTGLGAP
YWDSNSRGAIFGLERGTKREHIVKATLDSIAYQSNDLLKAMEKDLEKPIILLKVDGGASK
SNYLMQFQSSISNLNVERPSKIETTGLGASYLAGLAVGYWKDLEELKTLNKPEKVFEPLL
SKTEIDKLLKGWDLAVRKTLNWTKDIE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaatttgttatcacacttgactcaggtaccacttcatgtcgtacacttgtg
gttaatcatgatggtgaaatagtagcaagtagtcaaacagaatttacccaatatttccct
cgatctggatgagttgagcatgacccattagaaatttgaaatactcaattatctacaatg
caatctgcaaaacataaagcaaaaattaaatcacatgatattgctgcattgggtattaca
aatcaacgtgaaacaattgtattatgagataaggaaactggtttaccagtatataatgct
attgtttgacaagatcgtagaacatcagattattgtgatgaacttgtaaaagcaggatga
acagaaaagatcactgaaaaaactggtttaattattaatccatattttagtgggacaaaa
attcgttgaatccttaaaaatgttccagaagcacaaatgaaatttaaagaaggtaagtta
ttggcaggtacaattgatacatgattaatgtgaaaattaactgatgcaaaagtacatgca
actgatgtttcgaacgcttcaagaacaatgttatttaacattcatacacttgattgagat
caagagatcttggatcttttggaaatcccaagagaaattcttccagaagtaaaatcttcc
tcagaatactatggttatgtaaagccaacacattgatcaaataaagcggttggtgaagta
cctattactggtgtagctggtgaccaacagtcagctttatttggacaaatgtgtactgaa
gtcggtatggttaaaaatacttatggaactggatgtttcactttggttaataccggtaca
acaccagtaaaaagtaaaaacaagcttcttactacaattgcttgaaaattaggtaaagaa
aaaactgtttatgcattagaagggtcagtatttatagctggtgcagctattaaatgatta
agagactcaattagaattatttacgattcagctgaatcagatttctttacttcattggtt
gatgatgatcaaaaacaaagagtatacgttgttccatcatttactggtttaggagcacct
tattgagactcaaattctcgtggtgccatattcggactagaaagaggaacaaaaagagag
catatagttaaagctactcttgattcaattgcttatcaatcaaatgatttacttaaagca
atggaaaaagatttggaaaaaccaattatcttattaaaggtagatgggggtgcatcaaaa
tcaaattatttaatgcaatttcaatcatcaatctctaatttaaatgttgaaagaccttca
aagattgagacaacaggtttaggagcttcttatcttgctggacttgctgttggttattga
aaagacttagaagaattaaaaacactaaataaaccagaaaaagtttttgaacctctttta
tcaaaaactgaaattgacaaattattaaaaggttgggaccttgcggttagaaaaacctta
aattgaacaaaagatatagaatag

DBGET integrated database retrieval system