KEGG   Mycoplasma cynos: MCYN_0565Help
Entry
MCYN_0565         CDS       T02424                                 

Gene name
MCYN0565
Definition
M42 glutamyl aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mcy  Mycoplasma cynos
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(608915..609985)
Genome map
AA seq 356 aa AA seqDB search
MKKLEFKQRLIKYMNIEAMSRYEQPVACELKANISSKYNVSYDKFGSIIFHKPSKNENAL
KIMIAAHMDEVGYLVKNITQKGQILLSPVGGIWASTVIGTKAKLITTQNKEFLGVFGHTS
IHIMERDKITKAISNDELYADFGFMSQEEAIQKGVEIGDRVQISGETVFFENEDLIGGKS
MDNRAGVSVLEYIANNLANFDLDVDLYLVGTVQEEVGTRGARTAVSLIKPDIAIALDTTS
SHDTYGTIPGTTELFKGAAIRIKDNGTLMDPKLVSLMMKTAKNHQIKAYKFIAAGGGTDA
AELQFSPNGGASVLTISLPQRYLHSPIGVCAISDLLAAGDLLTSFIKDFDSRKWNN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagaatttaaacaacgtttaattaaatatatgaatattgaagcaatgtca
agatatgaacaaccagtagcgtgtgaactaaaagcgaatattagttcaaaatataatgtt
tcatatgataaatttggttcaattatttttcataaaccatctaaaaatgaaaatgcatta
aaaattatgattgcagcacatatggatgaagttggttatttagttaagaacattactcaa
aaaggacaaattttattatcgcctgttggagggatatgagcttcaacagtgattggaaca
aaagcaaaattaattaccacacaaaataaggaatttttaggagtttttggtcatactagt
attcatataatggaaagagataaaatcacaaaagcaatttctaatgatgaactttatgca
gattttggttttatgagtcaagaagaagcaattcaaaaaggtgttgaaattggtgataga
gttcaaataagtggagagacagttttctttgaaaatgaagacctaattggtggtaaatcg
atggataatcgcgcaggtgttagtgttttagagtatattgctaataatcttgctaatttt
gacttagatgttgatttatatttagttggaacagttcaagaagaagttggaacaagagga
gcaagaacagctgtttcattaatcaaaccagatattgctattgcattggatacaacctca
tcacatgatacatatggaactattcctggaacaactgaattgttcaaaggtgcagcaata
agaataaaagacaatggtactttaatggatcctaagttagtttctttaatgatgaaaaca
gctaaaaatcaccaaattaaagcatataaatttattgcagctggtggtggaacagatgct
gcagagttacaattttcacctaatggaggagcatctgttttaacaatttcattaccgcaa
agatatttacatagtccaattggagtatgtgctattagtgatttattagccgctggtgat
ttacttacaagcttcattaaagattttgatagtagaaaatgaaataattaa

DBGET integrated database retrieval system