KEGG   Mycoplasma cynos: MCYN_0770Help
Entry
MCYN_0770         CDS       T02424                                 

Gene name
MCYN0770
Definition
F5/8 type C domain protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mcy  Mycoplasma cynos
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mcy00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mcy00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871045..874686
Genome map
AA seq 1213 aa AA seqDB search
MSKYFIFFIYGNDYRRENMNLKRKFLLICGGMSSVILLPLALVSTNPTTNDGTENGANIA
LGKSTEQNDFENGAEFKGSKAVDGDFNTRWATNQSDPSNGAKTLIIDLRSEQKVSSFQLF
LERDNITGFKLFASNQKENLDNDANKVFEWIESKQNLRRTIYYGNFTSIKENVRYVMLKV
TNWSESGRTIKPNLKWKNISVKELELYTEPMDLQNNIYNVLEKIQDWRPTINADGNKITL
PEGIDSSRIEIHADYEQIIDSKGNVFKPLTSKTVELLVIYTDKKGKKHKVKPASNLEVTG
KFVQQKNKNPKPKVAVEIAEWYSNSNDNLKLNKDFKIFVKGKLDEKLNKMFNELKLDFKD
IFNKEIEIKSFVDSDTTNGNIVFDLTENKIPGYDEETYEMIIDNDVTIKTANKIGAFWST
RTLLQMLKSSENFELPKGQMKDYPKFKKRGLSFDVGRKAVSMDILKAIVKEMSWYKMNEL
QVHLSDNLIFLEDYVSDKKEDKDIERSFDAYSGWRLESSKYKEVDGKKVYLHNEDYHYTI
DEFKKFMNDSNDLSVNIVPELDFPAHALSITKIWKEFAVKKFGTNANGKRTLVDHIDITN
PEAVKLIKEILDDYTNEGKIFDKNSRTTVHIGCDEFFDNPDAYYDFANEMFKYFIDKGIQ
VRLWGSFTHIRSASKHIKEEYKDKVEMNIWSLGWADPSAMYDEGYKLINTLDSPTYMVPN
GTGSRGAYRDFLNNKNIYDHYEANIMGNSNIPSGSPQMLGGMYAIWGDSLLDVRATGVSE
YDLFERFKDALPYFATKVWGIGSDGLDSTFEEYRDNVISKIGSAPNSNPSHKIKLEKKSS
HYFSYDFKGSNDSEKLLDKKGKFGIMNLSSGMSTSNEEGISSLKVVDKTAKAATNIDLLG
FNNRIKFVIKRQKVSDVQEEEVIFSADTPYGQLAIKARQKGSTKFGFSRELMDYTFDYEL
PYDKWVEIELVSEFDNAKKVAITKLFVNGKETGGKPVGTNGSRLIDKKTGEYKVEHTFTN
SSSLFIPLQYIGDGKNTFKGYITNIEHSLNEADKNKFEKSVLENIDFSLKLLKNNNVTAS
DISIEGIDKDKIMSDIQLISKDDKKLVVKVTLSYKNDPNISIVKNKIIDLENKSDSVVEP
LKPKNNKDNKKTKEEPNSTNKETPKDSSDKLLEKTNDDKNTSKIGTYIASAIAAMFGSIA
LVLGVLLFKNKNK
NT seq 3642 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaatattttatattttttatatatggaaatgattacaggagagagaatatgaat
ttaaaaagaaaatttctattaatttgcggcggaatgtctagtgttatcctattgccatta
gcactagtttctactaacccaacaacaaatgatggtactgaaaatggtgcaaatatagca
ttaggcaaatctacagaacaaaatgatttcgaaaacggtgctgagtttaagggatcaaaa
gctgttgacggagattttaacacaagatgagcaactaatcaaagcgatccttcaaatggg
gctaaaactttaataattgatctaaggtcagagcaaaaagttagctcatttcaattattt
ttagaaagagataatattacaggatttaaactttttgcttctaatcaaaaagaaaatttg
gacaatgatgcaaataaagtttttgaatgaattgaatcaaaacaaaatttaagaagaacc
atttactatggtaattttacttccattaaagaaaatgttagatatgtaatgcttaaagtg
actaattgaagcgagagtggtagaaccataaaacctaacttaaaatgaaaaaacatttct
gtgaaagaactagaattatacactgaacctatggaccttcaaaacaacatttataatgta
ttagaaaaaattcaagattgaagaccaacaattaatgcagatggtaataaaattacttta
cctgaaggaattgattcttctagaattgaaattcatgctgattatgaacaaataatagat
agcaaaggtaatgtttttaaacccctcacttccaaaactgttgaattattagttatctat
acagataaaaaggggaaaaaacataaagtgaaacctgcttctaatttggaggttactgga
aaatttgttcaacaaaaaaataaaaacccaaaaccaaaggtagctgttgagatagcggaa
tgatattcaaactcaaatgataatcttaaattaaataaagactttaaaatttttgttaaa
ggtaaattggatgaaaaactaaataaaatgtttaatgaattaaaattagattttaaagat
atttttaataaagaaatagaaattaaatcttttgttgattcagatacaacgaatggaaat
atagtttttgacttaacagaaaacaaaattccaggttatgatgaagaaacatatgaaatg
attattgataatgatgtaacaattaaaacagcaaataaaatcggtgctttttgatctaca
agaacacttttacaaatgcttaaaagtagcgaaaactttgaactaccaaaaggacaaatg
aaagattacccaaaatttaagaagagagggctttcatttgatgtgggaagaaaagcggtc
tcaatggatattttaaaagctattgttaaagaaatgtcatggtataaaatgaatgaactg
caagttcacttaagtgacaatttaattttcttagaggattatgtatcagataaaaaagaa
gataaagatatagagagatcatttgacgcatattcaggctgaagacttgaatcttcaaaa
tataaagaagtagatggtaaaaaagtatatctacacaatgaagattaccactatacaatt
gatgagttcaaaaaatttatgaatgattcaaatgatttaagtgttaatattgttccagaa
ttagactttccagctcatgctctatcaattacaaaaatttgaaaagaatttgcagttaaa
aaatttggtacaaatgctaatggtaaaagaacattggttgatcatattgatatcacaaat
cctgaggctgttaaacttattaaagaaattttggatgattatacaaatgaaggaaaaatt
tttgataaaaactctagaacaacagtgcatataggttgtgatgaattctttgataaccct
gacgcatattatgacttcgcaaatgaaatgtttaaatactttatcgataaaggaattcaa
gttaggttatggggtagttttacacatataagaagtgcttctaaacatataaaagaagag
tataaagataaggtggagatgaacatttgaagtctaggttgagctgatccttcagcaatg
tatgatgaaggctacaaattaattaacactcttgatagtcctacttatatggttcctaat
ggaacaggttcgagaggtgcttatagagattttttaaataacaagaatatatacgatcat
tatgaagcgaatataatgggtaactcaaatattccgtccggttcacctcaaatgttaggt
ggtatgtacgctatttgaggggattctttattagatgtaagggctactggtgttagtgaa
tatgatttatttgagagattcaaagatgcactaccatattttgctactaaagtttgaggc
atcgggtctgatggattagactctacatttgaagaatatagagataatgtaatttcaaaa
attggtagtgccccaaattcaaacccttctcacaaaattaagttagagaaaaaatcttct
cactattttagttatgatttcaaaggttctaatgatagcgaaaaacttctagataaaaag
ggaaaatttggaattatgaatctttcttcaggaatgagtacttctaacgaagaaggaatt
agttctctaaaggttgttgacaaaacagcaaaagcagccacaaatattgatttactaggc
tttaataatagaattaagtttgtaattaaaagacaaaaagtttctgatgttcaagaagaa
gaagttatttttagcgccgatactccatatggtcaattagcaataaaagcaagacaaaaa
ggttctactaaatttggtttcagcagggagttaatggattatacttttgattatgaatta
ccatatgacaaatgggttgaaattgaattagttagtgaatttgataatgcaaaaaaggta
gcaattactaaattgtttgtaaatggaaaagaaacaggaggaaaacctgttggaacaaat
ggttcaagattaatagataaaaaaactggtgaatataaagttgaacatacattcacaaat
tcttcatcacttttcattcctttgcaatatattggagatggtaaaaacacatttaaagga
tacataactaatattgaacattctcttaatgaagcagacaaaaataaatttgaaaaaagt
gtattagaaaatatagatttttcacttaagttactaaaaaataataatgtaacagcaagt
gatatttcaatcgaaggtattgataaagataagataatgagcgacattcaattaatttct
aaggatgataaaaaactagttgttaaagtcactttatcatataaaaatgatccaaatatt
agtatagtcaagaacaaaataatagatttagaaaataaatcagatagtgttgttgagcca
ctaaaaccaaaaaataacaaggataataagaaaacgaaagaagagccaaattcaacaaat
aaagaaacgccaaaagattcttccgataaattgttagaaaaaacaaatgatgacaaaaat
acgtcaaaaattggaacatatatagctagtgctatagcagcaatgttcggttcaatagcc
ttagtgctaggagtattgttatttaagaacaaaaacaaataa

DBGET integrated database retrieval system