KEGG   Mycoplasma cynos: MCYN_0782Help
Entry
MCYN_0782         CDS       T02424                                 

Gene name
MCYN0782
Definition
Putative beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mcy  Mycoplasma cynos
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MCYN_0782 (MCYN0782)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MCYN_0782 (MCYN0782)
Enzymes [BR:mcy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MCYN_0782 (MCYN0782)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
886396..890355
Genome map
AA seq 1319 aa AA seqDB search
MSKKFYVLNTLIGASIIVPMITISQSNTIKNKNEIKDNKSKNIALFKKVESSSVNDPVTI
GPERVVDGKKNTQWVSNRFEDAPIGGKTQSGYQSPAKDGKGSWLLIDLGEKQKVGSFQIF
LDRDNISEYEIYASDTKENIDKQENKVYSWKKSDNDLEQLVLFGNFKQVKENVQFVKFKA
LKWQKQGRTQVFKNEFEKRRLKNSIYVNEFELYADAMNLEKNPYKILQKYENWNPEYDST
KKQIKLPDGIDLKTTKIKADYEQIVDENGKVTQPLTDKDVEILLVHTDENGRRYPLKPKK
PKITIPGLHKQQDNKNQKPKVTVEIAEWWSDSSEKLKIKDNLKVFVKGNLSPEIKKILDE
FKKDYKALFNKELSYQSFDKDAELKNNVILDLSNKNINGFDNETYKISIEDNVIITATHK
TGANWATRTFLQMLLLDKDFSIPKGIMKDYPKYKVRGFSIDVGRKPISMQLLKDIVKQMS
WYKLNELQVHLSDNLIQLDDYSSEKNTEKDFENSFNAYSGWRLESSKYKEINGKKHYLHN
DDYHYTKKEFKEFMNYAHEYGANIVPELDFPAHALSITKIWKEFAIKQFNDKSQYGSLHK
PLTDHIDIKKEGARKLIKEILDDYTKDGAIFDKASGSTVHMGADEFYVDHDAYYDFVNEM
FKYFIDKGIQVRLWGSFSAFRSKTRFIKPEYRDKVQMSIWNIGFSHPQDMYNDGYNIINV
IDSPGYIVPDGEGQKGPYKDFLDNSKVYQEYEANTYLWLNGKVEHKVELPSGSDQVLGGM
FALWGDKLLDTRATGLNEYDLYERFKDAAPYYATKLWGIGSDGLDSEFEDYKNNIVNKLG
QAPGINPEHKISLNKNQRQYFKYDFKGKTKEEKLLDKTGDFGILNLSNNVELVDDEGINA
LKINDKTSKVNLNLGLIGFDNKISFKIKRSKPKTDQEEEVIFSADAPYGQIAIKAKQKGS
KNFGFSRELMDYTFNYELPYDKWVNIELVSEFDKDKKLAKTKLFVDGRETGGEAIGTNGS
MKYNYNTNKPEIHTFKNSSLFLPLDYIGDGKNTFSGLITDIEHVSKFKDDKNKTKYEALD
KIQPKLSTVKVNKVEINDINISYIDEAKYDYQAKILHKYSDFIVVNITISDKTNKDIFIS
KNFVLTLHSTELAQTKQIIEAIKGSSEYNELLKSLNKEETTLEQLNSINLRANEILKNQK
QKTFNLLNQLKNDNNLKPELKNKLDQAKSYNELLELNKEISKALEQQNLKSIEKPKEPQK
PKTPDKPIDKPKTQNKKTKEISKKSISGIIIGIIVSIITLLLIISGIYFIKTKKNKNKN
NT seq 3960 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaattttatgtattaaacactttgataggagctagtattatagttccaatg
attactatttcacaaagcaatacaataaaaaataaaaatgaaattaaggataacaaaagt
aaaaatattgccctttttaaaaaagttgaatcaagttcagttaatgatcctgtaacaatt
ggaccagagagagtagtggatggtaagaaaaacactcaatgagtttcgaataggtttgaa
gatgctccgatcggtggaaaaacccaaagtggatatcaaagtccagcaaaggacggaaaa
ggatcgtgattattaattgatctaggtgaaaaacaaaaagtaggctcatttcaaatattc
ctagatagagataatatttctgaatatgaaatttacgcttcagatacaaaggaaaatatt
gataaacaagaaaataaagtatatagttgaaaaaagtctgataatgatttagaacaatta
gtattatttggcaacttcaaacaagtcaaagaaaatgtccaatttgttaaatttaaagca
ttaaagtgacaaaaacaaggcagaacacaggtttttaaaaatgaatttgaaaaaagaaga
ttaaaaaatagtatttatgtaaatgaattcgaactgtacgctgatgctatgaatcttgag
aaaaatccatataaaatattacaaaaatatgaaaactgaaatcctgaatatgactcaacc
aaaaaacaaataaaattacctgatgggattgatttaaaaactacaaaaataaaagctgat
tatgaacaaatagttgatgaaaatggaaaggttactcaaccacttactgacaaagatgtt
gaaattttattagtgcatactgatgaaaatgggagaagatatccacttaaaccaaaaaaa
ccaaaaatcactatcccgggattacataaacaacaagataacaaaaatcaaaaaccaaaa
gtaacagttgaaattgctgaatgatgatcagattcatctgaaaaactaaaaattaaagat
aatttaaaagtatttgtaaaaggtaatttaagtcctgaaataaaaaaaatattagatgaa
tttaaaaaagattataaagcattatttaataaagaattaagttatcaatcttttgataaa
gatgctgaattaaagaataatgttattttagatttatcaaataaaaacattaatggtttt
gataatgaaacatataaaatatctattgaagataatgtaattatcacagcaacacacaag
acaggtgcaaattgagcaacaagaacatttttacaaatgttgctattagataaagatttc
agtattccaaaaggaataatgaaagattaccctaaatacaaagttagaggtttttctatt
gatgttggtcgtaaaccaatttcaatgcaacttttaaaggatattgttaaacaaatgtct
tggtataagctaaatgagcttcaagtacatttatcagataatttaattcaacttgatgat
tattcatcggaaaaaaatacagaaaaagattttgaaaatagttttaatgcatattcagga
tgaaggttagaatcaagtaaatataaagaaattaatggtaaaaaacattacttacataat
gatgattatcactatactaaaaaagaatttaaagaatttatgaattatgcacatgaatat
ggtgcaaatattgttcctgaattagacttcccagcgcatgctctttcaatcactaaaatt
tgaaaagaatttgctattaaacaatttaatgataaaagtcaatatggaagcctacataaa
cctttaacagatcatattgatattaagaaagaaggtgcaagaaaacttattaaagaaatt
ttagatgattataccaaagatggtgcaatatttgataaagcttcaggctcaactgttcat
atgggtgcagatgaattttatgtcgatcatgatgcgtattatgattttgttaatgaaatg
tttaaatattttatagataaaggtattcaagttcgcttatgaggtagtttttcggcattt
agatcaaaaactagatttataaaaccagagtatcgagataaagttcaaatgagtatttga
aatataggattttcacatccgcaagatatgtacaatgatggttataacattataaatgta
attgattcacctggatatatagttccagatggagaaggacaaaaaggcccatacaaagac
tttttagataactctaaggtatatcaagaatatgaggctaatacttacttatgattaaac
ggaaaagtagaacacaaggtagaactaccatcaggttcagatcaggttttgggtggaatg
tttgctttatgaggcgataaactcctagatacaagagcaacagggttgaatgaatatgac
ctatatgaaaggttcaaagatgctgctccttattatgcaactaaattatgaggaattggt
tcagatggtttagattctgaatttgaagattataaaaataatattgttaataaactagga
caagctccaggaattaatcctgaacataaaataagtttaaataaaaatcaaagacaatac
tttaaatatgattttaaaggaaaaacaaaagaagaaaaattgttagataaaactggtgat
tttggaattttaaatctatctaataatgttgaattagtggatgatgaaggtataaatgca
cttaaaataaatgataaaacatcaaaagttaatttaaatcttggtttaatcggttttgat
aacaagatttcatttaaaatcaaaagatctaagcccaaaactgatcaagaagaagaagtg
atatttagtgcagatgctccatatggacaaattgctattaaagcaaaacaaaaaggttca
aagaattttggatttagtcgtgagttaatggattatacttttaattatgaattaccttat
gataaatgagtaaatattgagttagtaagtgaatttgataaagataaaaagctagctaaa
acaaaattatttgttgatggaagagaaactggtggtgaggcaatcggaacaaatggttca
atgaaatataattacaatacaaataaaccagaaattcatacatttaaaaattcatcatta
tttttacctttagattatattggagatggtaaaaacacatttagtggtttgataaccgat
attgaacatgtaagcaaatttaaagatgataaaaataaaacaaaatatgaagcactagat
aaaattcaaccaaagctatcaacagtaaaagtaaataaagttgaaattaatgatattaac
atctcatatattgatgaagcaaaatatgactatcaagcgaaaatacttcataaatatagt
gattttattgtagtgaacataactattagtgataaaacgaataaagacatttttatatca
aaaaactttgtattaactttacacagtactgaactagctcaaacaaaacaaataattgaa
gctattaaaggttcaagtgagtataatgaattattaaaatctttaaataaagaagagaca
actcttgaacaattaaatagtataaatcttagggcgaatgaaatacttaagaatcaaaaa
caaaaaacttttaatcttttaaatcaattaaaaaatgataataacttaaagccagaatta
aaaaataaattagatcaagcaaaaagttataatgaactgttagaattaaataaagaaatt
tcaaaagctctagagcaacaaaatctaaagtcaatagagaagccaaaagaacctcaaaaa
ccaaaaacaccagataagccaattgacaaaccaaaaacacaaaataaaaaaacaaaggaa
atttcaaaaaaatcaatatctggtattataattggcatcattgtctctattattacttta
ttactaataattagtggaatttactttatcaaaacaaagaaaaacaaaaataaaaactaa

DBGET integrated database retrieval system