KEGG   Mycoplasma cynos: MCYN_0833Help
Entry
MCYN_0833         CDS       T02424                                 

Gene name
MCYN0833
Definition
Putative recombination protein
Orthology
K06187  
recombination protein RecR
Organism
mcy  Mycoplasma cynos
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCYN_0833 (MCYN0833)
DNA repair and recombination proteins [BR:mcy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MCYN_0833 (MCYN0833)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(934479..935069)
Genome map
AA seq 196 aa AA seqDB search
MFNSDKINNFISRLIKLPGITKKSAEKIVYWIFETDESEVNLLANAFRNVKENTTFCQMC
TNPIFNDEECEICTDDSRENKLLVVESLQILNKIEKANFFKGKYFVFGKKLKSDYLIEKE
IDLINKLSEYAKGFDEVILGISPNFDGEIIKYVLRKYLKNNAKKISELAIGLPIGSSVDY
IDEMTLKQSLINRTKE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtttaattcagataaaatcaataattttatttcaagacttataaagttaccaggaata
actaaaaaatcagcggaaaagatagtttattgaatttttgaaaccgatgaatcagaggta
aatctattagcaaatgcatttagaaatgtgaaagaaaacactactttttgtcaaatgtgt
actaatcctatttttaatgatgaagaatgtgaaatttgtacagatgattctagagaaaat
aaattattagtagtcgaatcactgcaaatacttaataaaatagaaaaagctaattttttc
aaaggaaagtattttgtatttggtaagaaattaaaaagtgattatttaattgaaaaagaa
atagatttgattaataaattaagcgaatatgcaaaaggatttgatgaagtaattttagga
atttcaccaaattttgatggtgaaattatcaaatatgttctaagaaaatatttaaaaaat
aatgcaaaaaaaataagtgaattagcaattggacttccaattggttcctcagttgattat
attgatgaaatgacacttaaacaatcacttattaatagaacaaaagaataa

DBGET integrated database retrieval system