KEGG   Mycoplasma cynos: MCYN_0883Help
Entry
MCYN_0883         CDS       T02424                                 

Gene name
MCYN0883
Definition
Exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mcy  Mycoplasma cynos
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCYN_0883 (MCYN0883)
Enzymes [BR:mcy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCYN_0883 (MCYN0883)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(995448..997787)
Genome map
AA seq 779 aa AA seqDB search
MEKIVLKENEELISGRIIKTLKENKPQGWGLFMVETIEKEKIVIYMSKNIPKIYEDYDFV
ITKSNRGANNTYILNNYFKVQKKIDKEMELLQYLKKTPKVGFAAIDKINKKYTFKGFYKS
IKENEIFNEDFADFLNQQQKENILVVYKENEEKILNLISDTEEIDNDLFFFELNKLQNLY
LKLLEFHGKDVNFKTFYKSNNPYKLYLENQFPLKEIDIFALALGWSESSFERLEAYLNVL
MIKLEDNNSTYIDKNEIISLLQNELNFAVTEPILNDFLDNLVKQGKLIAIDNLICRKEMY
IKEEFISSTLLKISKRKIVTLEKIDENEISYLSDNQREAYYSFLNSNISIITGGPGTGKS
NLIKHIYNTLKKEGYVYNEDFIVLAPTGRAAANISFKNGFTSRTIHSFLNIANDEEKINQ
SPKEYDNFKILIIDEFSMVNINVFYLLLSMCRKIKKIVLLGDVDQLPAIGPGNLLTDLIN
SNKFRTMYLKQNFRSESSEIIEYINFINCIGDFENESHNEQLVNFIKDEYKINDLNFKLS
EFKNTIYTKFCDFYGNSLKQKNIEMYIFNDFLKDISTLFEEKVKIYGVENVVILCPIYKG
SYGIDKINKIIQNKFNREGKEIFSYKIFDNEFIFKENDKVIQLVNKHEKNISNGDIGFIE
RIEKDNTSKEKELIVVRFETNGKKRYVSYTKDEFKTEVKLAYAITIHKFQGSEINCAIFI
VHPDHSRMLTRKLVYTAASRAIKKLVIFTKYENIYSKIFLKEFLNNKKIITNLLWMLKE
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatagttttaaaagaaaatgaagaattaatttcaggacgaataataaaaact
ttaaaagaaaacaaacctcaaggttgaggtttgtttatggtcgagacaatagaaaaagaa
aaaatagttatttatatgtcgaaaaacataccgaaaatatatgaagattatgattttgta
attacaaaatcaaatagaggagctaataatacatatattttgaataactattttaaagtt
caaaaaaagatagataaggaaatggaacttcttcaatatcttaaaaaaacaccaaaagtc
ggttttgctgccattgataaaattaataaaaaatatacatttaaaggtttttataaatca
attaaagaaaatgaaatttttaatgaagatttcgctgattttttaaatcaacaacaaaaa
gaaaatattttagtggtttataaagaaaacgaagaaaaaatattgaacttaataagtgat
actgaggaaatagataatgatctgttcttttttgagttaaataaacttcaaaatttatat
ttaaagttgttagaattccatggtaaagatgtaaattttaaaacattttataaatcaaat
aatccttataagttatatttagaaaatcaattcccattaaaagagatagatatatttgca
ttagctttaggatgaagtgaatcttcttttgaaagactagaagcttatttaaacgtgctt
atgattaaattagaagataataattctacatatatagataaaaatgaaataatttcatta
ttgcaaaatgagttaaattttgctgttactgagccgattttaaatgattttttagataat
ttagtaaaacaaggaaaattaattgcaatagataatttaatttgtagaaaagaaatgtac
ataaaagaagaatttatttctagcacattattaaaaataagcaaaagaaaaatagtaaca
ttagaaaagatagatgaaaatgaaatatcttatttatctgataaccaaagagaagcgtat
tattcatttttaaattcaaatattagtataattacgggtggtcctggaacaggaaagagt
aatttaataaagcatatctataacactttaaagaaagaaggctatgtatataatgaagat
tttatagttttagccccaacaggtagagcagcagctaatatttcatttaaaaatggattc
acttctagaactattcatagttttttaaatattgctaatgatgaagaaaaaataaatcaa
agtcctaaagaatatgataattttaaaatattaattattgatgaatttagtatggttaat
attaatgttttttatttattactttccatgtgtagaaagataaaaaaaatagttttatta
ggtgatgtagaccaacttccagctattggtcctggtaatttattaaccgatttaataaat
tcaaataaatttagaacaatgtatttaaaacaaaattttcgctctgaaagttctgaaatt
attgaatacattaattttataaattgtattggtgattttgaaaatgaaagtcataatgaa
caacttgttaattttataaaagatgaatataaaattaacgatttaaattttaaattaagt
gagtttaaaaatacaatttatacaaagttttgtgacttttatggtaattcattaaaacaa
aaaaacatagaaatgtatatttttaatgattttttaaaagatatttcgactttatttgaa
gaaaaagtaaaaatttacggtgttgaaaatgtagttattttatgcccaatttataaaggt
tcatacggcattgacaaaattaataaaattattcaaaataaatttaatagagaaggaaaa
gaaattttttcctataagatctttgataatgaatttatttttaaagaaaacgataaagtt
attcaattagttaataagcatgaaaaaaatatttcaaatggtgatataggctttattgag
agaatagaaaaagataatacatctaaggaaaaagagttaatagttgttaggtttgagaca
aatggtaagaagcgttatgtttcatatacgaaagatgaatttaaaacagaagtaaaatta
gcttatgcgattactattcataaatttcaaggaagtgaaattaattgtgctatttttatt
gttcatccagatcatagtagaatgttaactcgtaagttagtttatacagctgcttctaga
gcgattaaaaaacttgttatatttactaaatatgagaatatttattcaaaaatttttcta
aaagagttcttgaataataaaaaaattatcactaatttattatgaatgttaaaggaataa

DBGET integrated database retrieval system