KEGG   Mycobacterium canettii CIPT 140070017: BN45_10070Help
Entry
BN45_10070        CDS       T02422                                 

Gene name
celA
Definition
Possible cellulase CelA1 (endoglucanase) (endo-1,4-beta-glucanase) (FI-CMCASE) (carboxymethyl cellulase) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN45_10070 (celA)
Enzymes [BR:mcz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BN45_10070 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65933..66949
Genome map
AA seq 338 aa AA seqDB search
MMSSAIGSVARWIVPLLGVAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPAS
AAMVAARNANPPNAELTSVANTPQSYWLDQAFPAATVGGTVASYTGAAQAAGAMPVLTLY
GIPHRDCGSYASGGFATGADYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQER
FDLVRYAVDALTRDPAAAVYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTTD
EEIGYGEAISGLTNGSHYVIDTSRNGAGPAPDSPLNWCNPSGRALGAPPTTATAGAHADA
YLWIKRPGESDGTCGRGEPQAGRFVSQYAIDLAHNAGQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtcatcagctattggttcggtcgcgcggtggatagtccccctcctgggggttgca
gccgttgcttccatcggtgttatcgcggacccggtgcgggtcgttcgggccccggcgttg
atcctggtcgatgcggcaaacccgctggccggaaagcccttctacgtcgatcccgcctcg
gcggccatggtcgccgcgcgcaacgccaacccgccgaacgccgagctgacctccgtcgcc
aacaccccgcagtcctactggctcgaccaggcattcccggcggcgaccgtcggcggcacg
gttgccagctacaccggcgcggcgcaggctgccggcgccatgccggttctgacgctttat
ggaatcccccatcgcgactgcggtagctacgcatccggtgggttcgcgacgggcgctgac
taccgcgggtggatcgacgccgtcgcatccggcctgggctcatcgcctgcaacgatcatc
gtcgaacccgacgcgctcgccatggccgactgcctgtcgcctgaccagcgccaagaacgt
ttcgacttggtgcgctacgccgtcgacgcactgacccgtgacccggccgctgccgtgtac
gtcgatgcggggcattcgcgctggctgagcgccgaggcaatggcagccaggctcaacgac
gtcggtgtgggccgcgcgcgcgggtttagcctcaacgtctcgaacttctacaccaccgat
gaggaaatcggttacggcgaggcgatttcggggctcacgaacggttcgcattacgtgatc
gacacgtcgcgcaacggcgccggaccagcacccgactccccgctcaactggtgcaacccc
agcggccgcgccctgggcgcaccgcccaccacggccaccgcgggcgcgcacgccgacgct
tacctgtggatcaaacgtcccggcgaatccgacggaacctgcggtcgcggcgagccccag
gcgggtcggttcgttagccagtacgccatcgatctggcccacaacgccggccagtag

DBGET integrated database retrieval system