KEGG   Mycobacterium canettii CIPT 140070017: BN45_10267Help
Entry
BN45_10267        CDS       T02422                                 

Gene name
fadA
Definition
(GenBank) Putative acetyl-CoA acyltransferase FadA2 (3-ketoacyl-CoA thiolase) (beta-ketothiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN45_10267 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BN45_10267 (fadA)
   00640 Propanoate metabolism
    BN45_10267 (fadA)
   00650 Butanoate metabolism
    BN45_10267 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN45_10267 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BN45_10267 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN45_10267 (fadA)
   00310 Lysine degradation
    BN45_10267 (fadA)
   00380 Tryptophan metabolism
    BN45_10267 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN45_10267 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN45_10267 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN45_10267 (fadA)
Enzymes [BR:mcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN45_10267 (fadA)
Exosome [BR:mcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN45_10267 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
293238..294560
Genome map
AA seq 440 aa AA seqDB search
MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAALSGLVDRFGLAGERLD
MVVGGAVLKHSRDFNLMRECVLGSALSPYTPAFDLQQACGTGLQAAIAAADGIAAGRYEV
AAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTLPASLGVEIPANSEPRTG
LSMGEHAAITAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVSPFLGLYRDDNLRPS
SSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLASEQWAEAHSLAPLAYLVDAE
TAAVDYVNGNDGLLMAPTYAVPRLLARNGLNLQDFDFYEIHEAFASVVLAHLAAWESEEY
CKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAAKKGGGPL
RGLISICAAGGQGVAAILQA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggcccctgctgctaagaacacttcacagaccaggcggcgagtcgccgtgctgggcggc
aaccgcatcccgttcgccagatcggacggcgcctacgcggatgcgtccaaccaggacatg
ttcaccgcggcgctgagcggcttggtggaccgattcggactcgccggcgagcggctggac
atggtggtcgggggtgcggtgctcaagcacagccgcgacttcaacctgatgcgtgaatgc
gtgctggggtcggcgctttcgccctacacgccggcgttcgatctgcagcaggcctgcggc
accggcctgcaggcggccatcgcggccgccgacggaatcgccgccgggcggtatgaggtg
gccgccgccggcggggtggacaccacctcggacccgccgatcggcctgggcgacgacctg
cgccgcaccctgctcaagctgcgccgatctaggtccaacgtgcaacgcctcaagctggtg
ggcacgctgccggccagcctgggcgtggagatcccagccaacagtgagccgcgcaccggg
ctgtcgatgggcgagcacgccgccatcaccgccaagcagatgggcatcaaacgcgtcgac
caggacgagctggccgccgccagccatcgcaatatggccgacgcctacgaccggggcttc
ttcgacgacctggtcagtccgtttttagggctgtaccgagacgacaatctgcggcctagc
tccagcgtcgagaaactggccacgctgcgtccggtcttcggagtgaaagccggtgacgcg
acgatgacggccggcaattcgactccgctgaccgacggagcctcggtcgcattgctggcc
agcgaacagtgggcggaggcacactcgctggctccattggcctatctcgtggatgccgag
accgccgcggtcgactatgtcaacggcaacgacggcctgttgatggcgccgacctacgcg
gtaccccggctgctggcccgtaacgggttgaacctgcaggacttcgacttctacgaaatc
cacgaggcgtttgcctccgtggtgctcgcgcatctggcggcgtgggagtccgaggagtac
tgcaagcggcggctgggcctggacgccgcgctggggtcgatcgatcggtccaagctcaac
gtcaacgggtcgtcgttggccgccgggcaccccttcgcggcgacgggtgggcggattctc
gcgcagaccgccaagcagctcgccgagaagaaggcggcgaaaaaaggcggcggaccgctg
cgcgggctgatttcgatctgcgcggccggcggccaaggtgtggccgcgattcttcaggcc
tga

DBGET integrated database retrieval system