KEGG   Mycobacterium canettii CIPT 140070017: BN45_10504Help
Entry
BN45_10504        CDS       T02422                                 

Gene name
echA
Definition
Enoyl-CoA hydratase EchA2 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN45_10504 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN45_10504 (echA)
   00650 Butanoate metabolism
    BN45_10504 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN45_10504 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN45_10504 (echA)
   00310 Lysine degradation
    BN45_10504 (echA)
   00360 Phenylalanine metabolism
    BN45_10504 (echA)
   00380 Tryptophan metabolism
    BN45_10504 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN45_10504 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN45_10504 (echA)
   00281 Geraniol degradation
    BN45_10504 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN45_10504 (echA)
   00627 Aminobenzoate degradation
    BN45_10504 (echA)
   00930 Caprolactam degradation
    BN45_10504 (echA)
Enzymes [BR:mcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN45_10504 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(553704..554618)
Genome map
AA seq 304 aa AA seqDB search
MPRPDFQTLLYTTAGPVATITLNRPEQLNTIVPPMPDEIEAAIGLAERDQDIKVIVLRGA
GRAFSGGYDFGGGFQHWGDAMMTDGRWDPGKDFAMVTARETGPTQKFMAIWRASKPVIAQ
VHGWCVGGASDYALCADIVIASEDAVIGTPYSRMWGAYLTGMWLYRLSLAKVKWHSLTGR
PLTGVQAAEVELINEAVPFERLEARVAEIATELARIPLSQLQAQKLIVNQAYENMGLAST
QLLGGILDGLMRNTPDALEFIRTAQTQGVRAAVERRDSPFGDYSQAPPELRPDPTHVITP
DRSV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccgagacccgatttccagacgctgctgtacacgacggccgggccggtggccaccatc
acgctcaaccgcccggaacagctcaacaccatcgtcccgcccatgcccgacgagatcgag
gccgctatcgggttggccgagcgcgaccaggacatcaaggtcatcgtgctgcgcggtgcc
ggccgcgccttctccggtggttacgacttcggcggcggcttccagcattggggcgatgcc
atgatgaccgacggccgatgggatccgggcaaggatttcgccatggttaccgcgcgggag
accggaccgacgcagaaattcatggccatctggcgggcgtccaaaccggtgatcgcgcaa
gtgcatggttggtgcgtcggcggggccagcgactacgcgctgtgtgccgacatcgtgatc
gccagcgaggacgccgtgatcgggaccccgtatagccgcatgtggggagcctatttgacc
gggatgtggctgtatcgactcagccttgccaaggtcaaatggcactcgctgacgggccgg
ccgctgaccggtgtgcaggccgccgaagtcgagctgatcaacgaggcggtgccgttcgag
cggctcgaggctcgcgtcgccgagatcgccaccgagctggcacgaatcccgttgtcacag
ttgcaagcccagaaactgatcgtcaaccaggcctacgagaacatgggcctggcctccacc
cagctgctgggcggcattctcgacgggctgatgcgcaacacccccgacgcgcttgagttc
atccggaccgcccaaacccaaggtgtgcgagccgcggtcgagcgccgcgacagcccgttc
ggcgactacagccaagccccgccggaactgcgacccgaccccacgcacgtcatcactcct
gataggagcgtgtag

DBGET integrated database retrieval system