KEGG   Mycobacterium canettii CIPT 140070017: BN45_10566Help
Entry
BN45_10566        CDS       T02422                                 

Gene name
hemD
Definition
Putative uroporphyrin-III C-methyltransferase HemD (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN45_10566 (hemD)
Enzymes [BR:mcz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BN45_10566 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN45_10566 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
610936..612624
Genome map
AA seq 562 aa AA seqDB search
MTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVLALIGTDLPPV
SGPAPAEPVAGNGDAVGGGSAQEHGRAASAVVSGGPDIRPALGDPADVAKTLTAEARSGV
DVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVPTYAGLPLGSSHTVADVR
GDVDWDALAAAPGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQRSVETTL
QGLTDPAVLGATDPACSANGRDPQAGPLIVTIGKTVTSRAKLNWWESRALYGWTVLVPRT
KDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWIVFTSTNAVRA
VWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPSGEQSSLGLLDDFPPYDS
VFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATTREMIKTGGFDA
VCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPDTAAIGPLVDALA
EHAARLRAEGALPPPRKKSRRR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagggcgtaagccgagaccgggccgcatcgttttcgtgggctccggtccaggc
gaccccggcttgcttacgacacgggctgccgcggtgctggccaacgccgcgctggtgttc
accgatcccgacgtaccggagccggtgctggcgctgatcggcacggatctgccccccgtg
tccggcccggcgcccgccgagccggttgccgggaacggcgatgcggtcggcggaggaagt
gcgcaggaacacggccgggccgcatccgcggtagtctccggtggtcctgacatccgcccg
gcgctgggcgatcccgccgatgtggccaagacgctgaccgccgaggcccgttcgggtgtc
gacgtggtgcggctggtggcgggcgatccgctcacggtggatgcggtgatcagcgaggtg
aacgccgtcgcacgcacccacctgcacatcgaaatcgtgcccggcctggccgccagcagc
gcggtcccgacctatgccgggttgccgctgggttcgtcgcacaccgtcgccgacgtgcgc
ggcgatgtggactgggacgcgctggctgccgcacccgggccgctgatcctgcaggccacc
gcatcgcatctagccgaatcggcccgcagcctgatcgatcaccagctggccgagtccact
ccgtgcgtggtgaccgcacacggcaccacctgtcagcagcgttcggtcgagaccacactt
cagggattgaccgacccggccgtcctgggggctaccgaccccgcgtgctccgcaaacggg
agggacccccaggccggaccgctgatagtgaccatcggcaagacggtgaccagtcgggca
aagctgaactggtgggagagccgcgccctctacggctggacggtgttggtgccgcgcacc
aaggaccaggccggcgagatgagcgagcggctcacatcgtacggcgcgctgccggtcgag
gtgccgaccatcgccgtcgagccgccgcgcagccccgcgcagatggagcgcgccgtcaag
ggcctggtcgatggccgattccagtggatcgtgttcacctccaccaacgcggtgcgtgcg
gtgtgggagaagttcggcgagttcggtctggatgcccgcgcgttctccggggtgaagatc
gcctgtgtcggcgagtcgacggccgaccgggtgcgcgcctttggaatcagtcccgagctg
gtgccctccggggagcagtcctcgcttggcttgctagacgacttcccgccctacgacagc
gttttcgacccggtgaaccgggttttgctgccgcgcgccgacatcgccaccgaaacgctg
gccgagggactgcgagagcgtggctgggagatcgaggacgtcaccgcctaccggaccgtg
cgggccgcgccgccgccggccaccacccgggaaatgatcaagacgggcgggtttgacgcg
gtatgtttcacctccagctcgacggtgcgaaacctggtcggcatcgccggcaagccgcac
gcgcggacgatcatcgcctgcatagggccaaagaccgccgagaccgccgccgagttcggc
ttgcgggtcgatgttcagccggacaccgccgccatcggcccgctggtcgatgcgctggcc
gagcatgccgcccggttgcgcgctgagggtgcgctgcccccgccgcgcaagaagagccgc
aggcgctag

DBGET integrated database retrieval system