KEGG   Mycobacterium canettii CIPT 140070017: BN45_10744Help
Entry
BN45_10744        CDS       T02422                                 

Definition
(RefSeq) Putative glucokinase
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN45_10744
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN45_10744
   00052 Galactose metabolism
    BN45_10744
   00500 Starch and sucrose metabolism
    BN45_10744
   00520 Amino sugar and nucleotide sugar metabolism
    BN45_10744
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN45_10744
   00524 Butirosin and neomycin biosynthesis
    BN45_10744
Enzymes [BR:mcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BN45_10744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
781948..782856
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKIAAGLADPGGVLVHTATRPTPAHGGAEQVWAAVAEMIADALGVAGGAV
GGVGIASAGPVDLHSGRVSPLNIGSWRGFPLLNRVVAAVPGVPVRLGGDGVCMALGEHWL
GAGRGARFLLGMVVSTGVGGGLVLDGVPYFGRTGNAGHVGHVVVDPDGSTCPCGGRGCVE
TMASGPSMARWARANGWSAPSRVGAKELAEAAMAGDTVALRAFRRGARALAATIASVGAT
CDLDLVVIGGGVAKAGRLLFDPLRAALSDYARLDFLAGLRVVPAELGGDAGLVGAARLAA
IA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctctgcctggacatcggcggcaccaagatcgccgccggtctggccgatccc
ggcggcgtgctggtgcacaccgccacacgtcccaccccggcgcacggcggagccgaacaa
gtctgggccgcggtcgccgagatgatcgccgacgcgctcggcgtggcggggggcgccgtc
ggtggtgtggggatcgcctcggccggtcctgtcgacctgcacagcggccgggtcagtcca
ctcaacatcggatcctggcgcgggtttccgctgctgaacagggttgtcgccgcggtcccg
ggggtgccggtgcggctgggcggcgacggtgtctgcatggcgctcggcgagcactggctg
ggagctggacggggtgcacgctttctattgggcatggtggtgtccacgggtgtgggcggc
gggttggtgctcgacggtgtcccctacttcggccgcactggcaatgccggtcacgtcggc
cacgtggtggtggatccggatggctcgacgtgcccgtgcggggggcgcggctgtgtggag
accatggcatccggtccgtcgatggcgcgctgggcgcgggccaatggctggtccgcgccg
tcccgggtcggtgccaaagagctggccgaggcggccatggccggagatacggtggcgctg
cgggccttccgccggggcgcaagggcgctggccgcgacgattgcctcggtgggcgccacc
tgcgacctggacctcgtcgtcatcggcggcggcgtggccaaggcgggtcgcctgctgttc
gacccgttacgcgcggcgctatccgattacgctcgtctggactttctggccggcctgcgg
gtggtgcccgccgagctgggcggcgacgccggcctggtgggtgcggccaggctcgcggcc
atcgcatga

DBGET integrated database retrieval system