KEGG   Mycobacterium canettii CIPT 140070017: BN45_110074Help
Entry
BN45_110074       CDS       T02422                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN45_110074 (recR)
DNA repair and recombination proteins [BR:mcz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BN45_110074 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4277560..4278171)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCVVCG
NVSDGERCRICADPRRDGSQVCVVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQ
LRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRVLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggacccgtccaggacctgattgacgaactcggcaagttgccggggatcgga
cccaagagtgcgcagcgaatcgccttccacctgttgtcggtagaaccgtcggacatcgac
cggctgaccggtgtgctggccaaggttcgggacggcgtgcggttctgtgtggtctgcggc
aacgtctccgatggcgagcgttgccgaatctgcgccgatccgcgccgggacggctcccag
gtgtgtgtcgtcgaggaacccaaagacatccaggccgtcgagcgcacccgtgaattccgg
ggtcgctatcacgtcctgggcggtgcgcttgacccgctgtccggaattgggccagatcag
ctacggatccgcgaactgttgagtcgcatcggggaacgggtcgacgacgtcgacgtcacc
gaggtgatcatcgccaccgaccccaacaccgagggcgaggcgacggccacctacctggtg
cggatgctgcgcgacatccccggcctgaccgtcacgcggatcgcctccgggctgccgatg
ggcggcgacctggaattcgccgacgagctcaccctgggccgcgcgcttgccggccgccgc
gtgctcgcctga

DBGET integrated database retrieval system