KEGG   Mycobacterium canettii CIPT 140070017: BN45_20151Help
Entry
BN45_20151        CDS       T02422                                 

Gene name
fadB
Definition
(GenBank) Putative fatty acid oxidation protein FadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00071  Fatty acid degradation
mcz00280  Valine, leucine and isoleucine degradation
mcz00281  Geraniol degradation
mcz00310  Lysine degradation
mcz00362  Benzoate degradation
mcz00380  Tryptophan metabolism
mcz00410  beta-Alanine metabolism
mcz00640  Propanoate metabolism
mcz00650  Butanoate metabolism
mcz00903  Limonene and pinene degradation
mcz00930  Caprolactam degradation
mcz01040  Biosynthesis of unsaturated fatty acids
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01120  Microbial metabolism in diverse environments
mcz01130  Biosynthesis of antibiotics
mcz01200  Carbon metabolism
mcz01212  Fatty acid metabolism
Module
mcz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN45_20151 (fadB)
   00650 Butanoate metabolism
    BN45_20151 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BN45_20151 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BN45_20151 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN45_20151 (fadB)
   00310 Lysine degradation
    BN45_20151 (fadB)
   00380 Tryptophan metabolism
    BN45_20151 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN45_20151 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN45_20151 (fadB)
   00281 Geraniol degradation
    BN45_20151 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN45_20151 (fadB)
   00930 Caprolactam degradation
    BN45_20151 (fadB)
Enzymes [BR:mcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN45_20151 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN45_20151 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN45_20151 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored adh_short_C2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCK62988
Position
1006653..1008815
Genome map
AA seq 720 aa AA seqDB search
MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASA
KKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAK
AKEIGLVDELVATVEELVPAAKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAA
ILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEA
AAKGKGYSEKLEAKALERGRTTQERSDALLARITPTADAADFKGVDFVIEAVFENQELKH
KVFGEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGS
QAGYPAPPLQLSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWSGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDENVLTSTA
DANIGSIMGIGFPPWTGGSAQFIVGYSGPAGTGKAAFVARARELAAAYGDRFLPPESLLS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaacacaattcagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gatgatccctccgggtcaaccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gccgtcgatcgccttgtcgccgaaaaggattcgatcaccggagtggtagtcgccagcgcg
aagaagaccttcttcgccggtggcgacgtcaagacgatgatccaggccaggcccgaggac
gccggcgatgtattcaacaccgtcgagaccatcaagcggcagctgcgcaccttggagacg
ctgggcaagccggtcgtcgcggccatcaacggggcggcgttgggcggcgggctggagatc
gcgctggcgtgtcatcaccggatcgccgccgacgtcaaaggcagccagctcggcctgccg
gaggtgacgctgggtctgctgccgggcggcggtggggtgacccgcacggtgcggatgttc
ggcatccagaacgcgttcgtgagcgtgctggcgcaaggtacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgagctggtggcaacggtcgaggagctggtgcccgcc
gccaaggcttggataaaggaggagctcaaggccaaccccgacggtgccggggtgcagccg
tgggacaagaagggctacaagatgcccggcggcaccccgtcgtcgccgggtctggcggcg
attttgccgtcgttcccgtcgaacctgcgcaagcagctcaagggtgccccaatgccggcg
ccgcgggccatcctggccgccgcggtcgagggggcacaggttgacttcgacaccgccagc
cgcatcgagagccgctacttcgcgtcgttggtcaccggccaggtcgccaagaacatgatg
caggcgttcttcttcgacctgcaggccatcaatgccggcgggtctcggcccgaaggcatc
ggcaagaccccgatcaagaggatcggtgtgctgggtgcgggcatgatgggcgccggcatc
gcctacgtctctgcgaaggccggctatgaggtggtactcaaagatgtcagccttgaggcc
gccgctaaaggcaagggctactccgaaaagctggaggccaaggcgctggagcggggccgc
accacacaggagcgcagcgacgccctgctggcgcgcatcaccccgaccgccgacgccgcc
gatttcaagggcgtcgacttcgtgatcgaggcggtcttcgagaaccaggagctcaagcac
aaggtgttcggcgagatcgaggacatcgtcgagcccaacgcgatcctgggatccaacacc
tcgacgctgccgatcaccggtctggcgaccggcgtcaagcggcaggaagacttcatcggg
atccacttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acttccgacgaggctttggcccgggtgttcgactacaccttggccatcggcaagaccccg
atcgtggtcaacgacagccgcggctttttcacctcgcgggtcatcggcacgttcgtcaac
gaggcgctggcgatgctcggtgagggtgtcgagccggcttccatcgagcaggcggggtcg
caggccgggtatccggcgccgccgctgcagctgtccgacgagctcaacctggagctgatg
cacaagatcgccgtcgccacccgtaagggtgtcgaggacgccggcggcacgtaccagccg
catccggcggaggccgtggtggagaagatgatcgagctcggccggtcggggcggctgaag
ggcgcgggcttctacgagtacgccgacggcaagcggtccgggttgtggtccggcttgcgg
gaaacgttcaagtcgggctcgtcgcagccgccgctgcaggacatgatcgaccgcatgctg
ttcgccgaggcactggaaacccagaagtgtctcgacgagaacgtgctgacgtcgacggcc
gacgccaacatcgggtccatcatgggcatcggcttcccgccgtggacgggtggcagtgcc
cagttcatcgtcggctactccggcccggccggtaccggtaaggcggctttcgtggcccgg
gcccgcgagctggcggccgcctacggcgaccgcttcctgccaccggagtcgctgcttagc
tga

DBGET integrated database retrieval system