KEGG   Mycobacterium canettii CIPT 140070017: BN45_30021Help
Entry
BN45_30021        CDS       T02422                                 

Gene name
galU
Definition
(GenBank) Putative UTP--glucose-1-phosphate uridylyltransferase GalU (UDP-glucose pyrophosphorylase) (UDPGP) (alpha-D-glucosyl-1-phosphate uridylyltransferase) (uridine diphosphoglucose pyrophosphorylase)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00040  Pentose and glucuronate interconversions
mcz00052  Galactose metabolism
mcz00500  Starch and sucrose metabolism
mcz00520  Amino sugar and nucleotide sugar metabolism
mcz01100  Metabolic pathways
mcz01130  Biosynthesis of antibiotics
Module
mcz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN45_30021 (galU)
   00052 Galactose metabolism
    BN45_30021 (galU)
   00500 Starch and sucrose metabolism
    BN45_30021 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BN45_30021 (galU)
Enzymes [BR:mcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN45_30021 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: CCK63122
Position
1160772..1161692
Genome map
AA seq 306 aa AA seqDB search
MSRPEVLTPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAERLVI
VTSEGKDGVVAHFVEDLVLEGTLEARGKIAMLAKVRRAPALIKVESVVQAEPLGLGHAIG
CVEPTLSPDEDAVAVLLPDDLVLPTGVLETMSKVRASRGGTVLCAIEVAREEISAYGVFD
VEPVPDGDYTDDPNVLKVKGMVEKPKAETAPSRYAAAGRYVLDRAIFDALRRIDRGAGGE
VQLTDAIALLIAEGHPVHVVVHQGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVAR
LGLTEQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcccagaagtactaacgccgttcacggcaatcgtcccggcagccggcctgggc
acgcgctttctgccggccaccaagacggtgcccaaggagctgctgcccgtcgtcgacact
cccggtatcgagctggtggccgccgaggcggccgcggccggtgccgaacggctggtgatc
gtcacctccgagggtaaggacggggtcgtcgcgcatttcgtggaagacctggtgctggag
ggcacgctcgaggcccgaggcaagatcgccatgctggccaaggtgcgtcgcgccccggca
ctgatcaaggtcgaatccgtggtgcaggccgagccgctgggactgggacacgccatcggc
tgtgtggagccgacgctgtcgcccgacgaagacgctgtcgcggtgctgctccctgacgac
ctggttctgccgaccggcgtcctggagacgatgtcgaaggtgcgagccagcaggggcggc
accgtgctgtgtgctatcgaggtggcgcgcgaggagatcagtgcctacggggttttcgat
gtcgagccggtccccgatggtgactacaccgacgatcccaacgtgctgaaggtcaagggc
atggtcgaaaagcccaaggccgaaacggcgccgtcgaggtatgcggcggccggccgctac
gttctagaccgtgccatcttcgatgcgttacgccgcatcgaccggggtgcaggcggtgaa
gtgcagctcaccgatgcgatcgcgctgctgattgccgagggccatcccgtccatgtcgtc
gtccaccaagggtcccgacacgacctgggaaatccgggcgggtacctcaaggctgcggtt
gactttgcattggatcgtgacgactacggcccggacttgcggcgatggttggtggcgcga
ctgggtctgacagagcagtag

DBGET integrated database retrieval system