KEGG   Mycobacterium canettii CIPT 140070017: BN45_30367Help
Entry
BN45_30367        CDS       T02422                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN45_30367 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN45_30367 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN45_30367 (thrC)
Enzymes [BR:mcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN45_30367 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1513410..1514492
Genome map
AA seq 360 aa AA seqDB search
MTVPPTATHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASA
ASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgccgacggccactcaccagccgtggccgggagtgattgccgcgtaccgt
gaccggctgccggtgggtgacgactggactccggtgaccctgctcgagggtggtactccc
ctcatcgcggcaactaatctctccaagcagacgggctgcacgatccacctcaaagtggag
ggcctcaaccccaccggctccttcaaggatcgtggcatgacgatggcggtcaccgatgcc
cttgcccatggtcagcgggcggtcttgtgcgcatcgaccggaaatacctcggcgtcggcg
gcggcctatgccgcccgggccggcatcacctgcgcggtgctgataccgcagggcaagatc
gcgatgggcaagctcgcacaggcggtcatgcacggcgccaagatcatccagatcgacggt
aacttcgacgactgcctggaactggcgcgcaagatggccgcggacttcccgacgatttcg
ttggtcaactcggttaacccggtgcgcatcgagggccagaaaacggcagcgttcgagatc
gtcgacgtgctaggtaccgcgccggacgtgcatgctctgccggttggcaacgccggcaac
atcaccgcgtactggaagggctacaccgagtatcaccagctgggcctgatcgacaagttg
ccccgcatgctgggcactcaggccgcgggcgcggcgcccctggtgctcggcgaaccggtg
agccacccggagaccatcgcaaccgcgatccgcatcggctcgccggcgtcgtggacttcg
gccgtcgaggcacagcagcagtccaagggccgcttcttggccgcctccgacgaggagata
ctggccgcatatcacctggtggctcgtgtcgaaggcgtattcgtggagcccgcgtccgca
gccagcattgcgggtctcctcaaagcgatcgacgacggctgggtggcgcgtggttcgacg
gtggtgtgcacggtaaccggcaacggtcttaaggatcccgacaccgcgctcaaagacatg
ccgagcgtgtctccggttcccgtggacccggtagccgtcgtcgagaagctagggctggcc
tag

DBGET integrated database retrieval system