KEGG   Mycobacterium canettii CIPT 140070017: BN45_30408Help
Entry
BN45_30408        CDS       T02422                                 

Gene name
glgB
Definition
Putative 1,4-alpha-glucan branching enzyme GlgB (glycogen branching enzyme) (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN45_30408 (glgB)
Enzymes [BR:mcz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BN45_30408 (glgB)
Exosome [BR:mcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN45_30408 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1552664..1554889)
Genome map
AA seq 741 aa AA seqDB search
MSRSEKLTGEHLAPEPAEMAHLVAGTHHNPHGILGAHEYGDHTVIRAFRPHAVEVVALVG
KDRFSLQHLGSGLFAVALPFVDLIDYRLQVTYEGCDPHTVADAYRFLPTLGEVDLHLFAE
GRHERLWEVLGAHPRSFTTADGVVSGVSFAVWAPNAKGVSLIGEFNGWNGHEAPMRVLGP
SGVWELFWPDFPCDGLYKFRVHGADGVVTDRADPFAFGTEVPPQTASRVTLSDYTWGDDD
WMAGRALRNPVNEAMSTYEVHLGSWRPGLSYRQLARELTDYIVDQGFTHVELLPVAEHPF
AGSWGYQVTSYYAPTSRFGTPDDFRALVDALHQAGIGVIVDWVPAHFPKDAWALGRFDGT
ALYEHSDPKRGEQLDWGTYVFDFGRPEVRNFLVANALYWLQEFHIDGLRVDAVASMLYLD
YSRPEGGWTPNVHGGRENLEAVQFLQEMNATAHKVAPGIVTIAEESTSWPGVTRPTNIGG
LGFSMKWNMGWMHDTLDYVSRDPVYRSYHHHEMTFSMLYAFSENYVLPLSHDEVVHGKGT
LWGRMPGNNHVKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEQRGLDWFQLDENGF
SNGIQRLVRDINDIYRCHPALWSLDTTPEGYSWIDANDSANNVLSFMRYGSDGSVLACVF
NFAGAEHRDYRLGLPRAGRWREVLNTDATIYHGSGIGNLGGVDATDDPWHGRPASAVLVL
PPTSALWLTPAEISPPGGGHD
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatccgagaaactcaccggggagcaccttgcacccgagccggccgaaatggcg
cacttggtggcgggcacacatcacaacccgcacggcatcctgggcgcccatgaatacggc
gaccataccgttatccgagcgttccgtccgcatgccgtcgaggtcgtcgcgctcgttggt
aaggaccggttctcgttgcagcacctaggttctggcctgtttgccgtcgcattgccgttc
gtcgacctcatcgactaccgcctgcaggtgacctatgaaggttgcgacccacacacggtg
gccgatgcgtaccgattcctgcccaccctgggcgaggtcgacctgcacttgttcgccgag
ggccgccacgaacggctttgggaagtcctgggtgcccacccccgctcgtttaccacggcc
gacggtgtggtgagtggcgtgtcgttcgccgtgtgggcgcccaacgccaagggcgtcagc
ttgatcggcgagttcaacggttggaatggccacgaagcccccatgcgggtgctcggccca
tcaggggtatgggaactgttctggcccgacttcccttgcgacggtctgtacaagttccgc
gtgcacggcgccgacggcgtggttaccgatcgggccgacccgttcgcgttcggcaccgag
gtgccgccgcagaccgcatcgcgggtgaccttgagtgactacacctggggtgacgacgac
tggatggctgggcgtgcgctgcgcaacccggtgaacgaggcgatgagcacctacgaagtc
catctcggttcgtggcggcctggactcagctaccgccagcttgctcgcgagctcacggat
tacattgtggatcaagggtttacccatgtggagctgttgcccgtcgccgagcatccattc
gccggatcatgggggtatcaggtcacgtcctactatgcgccgacatcacgattcggcaca
cccgacgacttccgggcgctggtcgacgccctgcaccaggccggcatcggcgtcatcgtg
gattgggtcccagcgcacttcccgaaggacgcgtgggccctgggacggttcgacggcact
gcgctctacgaacattccgatcccaagcgcggcgagcaactggattggggcacatacgtg
ttcgacttcggccgcccggaagtgcgcaactttctggtagccaatgcgttgtactggcta
caagagttccacatcgacggcctgcgggtggacgcggtagcctcaatgctctatctagac
tactcgcgacccgagggcggctggacccccaacgtccacggcggccgggagaacctggaa
gcagtgcagttcctgcaggagatgaacgccacggcgcacaaggtcgcgccgggaatcgtc
accatcgccgaggagtccacgtcgtggcctggggtgacccgaccgaccaacattggcggc
ctgggcttttcgatgaagtggaacatgggctggatgcacgacacgctcgactacgtcagc
cgagatccggtgtaccgcagctaccaccaccacgagatgacgttctcgatgctctatgcg
ttcagcgaaaattacgtgttgccgctcagtcatgacgaggtggtgcacggcaaaggcacg
ctgtgggggcggatgccgggcaacaatcacgtcaaggccgccggcctgcgtagcctgctt
gcctaccaatgggcacaccccggcaagcaattgctgttcatgggtcaggaattcggccaa
cgcgccgaatggtccgagcagcgcggcctggactggttccaactcgacgaaaacggcttc
tccaacgggattcagcggctggtgcgcgacatcaacgacatctaccgatgccacccggcg
ctgtggagcttagacaccacccccgagggctattcttggatcgacgccaacgactcggcc
aacaatgtgttgagctttatgcgctacggcagcgacggctcggtgctggcctgcgtgttc
aatttcgcaggtgccgaacaccgtgactatcgactcgggctgccgcgcgcgggccgctgg
cgcgaggtgctcaataccgacgcgacgatctaccacggctcggggatcggcaacctcggc
ggcgtggacgctaccgacgacccctggcatggccgcccggcgtccgcggtgctggtgctg
ccgcccacttcggcgctgtggctgacgcccgctgagatatctcccccgggcggaggccac
gactga

DBGET integrated database retrieval system