KEGG   Mycobacterium canettii CIPT 140070017: BN45_40079Help
Entry
BN45_40079        CDS       T02422                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01130  Biosynthesis of antibiotics
mcz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN45_40079 (trpC)
Enzymes [BR:mcz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BN45_40079 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh
Motif
Other DBs
NCBI-ProteinID: CCK63748
Position
1873771..1874589
Genome map
AA seq 272 aa AA seqDB search
MSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREPGIGVIAEVKR
ASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRASVSIPVLRKD
FVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVHTEQEADRALK
AGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcaaccgtgctcgactccatcctcgagggagtccgggccgacgttgccgcg
cgtgaagcctcggtgagcctgtcggagatcaaggctgccgccgctgcggcgccgccgccg
ctcgacgtgatggccgccctacgcgagcccggcatcggcgtcatcgctgaggtcaagcgc
gctagtccttcggcgggcgcattggcgaccatcgccgacccggcaaagctggcccaggcc
taccaggatggcggtgcccggatcgtcagcgtggtgactgagcagcggcgttttcaggga
tcgctcgacgacctcgacgcggtgcgggcctcggtttcgattccggtgctgcgcaaggac
tttgtggtgcagccgtaccagattcatgaggcgcgtgcgcacggcgccgacatgttgttg
ctcatcgtcgccgcattggagcagtcggtgttggtgtcgatgttggaccgcaccgaatcg
ttgggtatgacagcactcgtcgaggtccataccgagcaggaagccgaccgggcgctgaag
gccggggccaaggtgattggcgttaacgcccgcgacctcatgacgctggacgtggaccgg
gattgcttcgcgcgaatagctcctggtttgccgagcagtgtgatcaggattgctgaatcc
ggcgtgcgtggcaccgctgacctgctggcgtacgccggcgcgggcgctgacgcggtgttg
gtaggcgaaggtctggtcaccagcggcgacccacgtgcggcggttgccgatctggttacc
gcgggcacccatccgtcctgtccgaaaccggctcgctag

DBGET integrated database retrieval system