KEGG   Mycobacterium canettii CIPT 140070017: BN45_50127Help
Entry
BN45_50127        CDS       T02422                                 

Gene name
adhA
Definition
(GenBank) Putative alcohol dehydrogenase AdhA
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00010  Glycolysis / Gluconeogenesis
mcz00071  Fatty acid degradation
mcz00350  Tyrosine metabolism
mcz00625  Chloroalkane and chloroalkene degradation
mcz00626  Naphthalene degradation
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01120  Microbial metabolism in diverse environments
mcz01130  Biosynthesis of antibiotics
mcz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN45_50127 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN45_50127 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BN45_50127 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN45_50127 (adhA)
   00626 Naphthalene degradation
    BN45_50127 (adhA)
Enzymes [BR:mcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN45_50127 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CCK63999
Position
2187072..2188112
Genome map
AA seq 346 aa AA seqDB search
MVSPATMATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEG
DLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDLGDRVGIAWLRHTCGVCKYCRRGSE
NLCPESRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELP
PGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALELGAASAQDAADRPPVPL
DAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQRHLFQERQIRSVTSNTRA
DARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaccggcgaccatggcgacgatgagtgcgtggcaggtgcgtcggcccggcccg
atggacaccggcccgctcgaacgagtgaccacccgggtgccgcgcccggcgccatcggag
ttgctggtggccgtgcacgcatgcggggtgtgccgcaccgatcttcacgtgaccgaaggt
gacctgcccgtacaccgcgaacgggtgattcccggccacgaggtagtgggagaggtcatt
gaggtgggctcagcggtgggcgcggctgccggtggcgaattcgacctaggagaccgggtg
ggtatcgcctggctgcgtcacacttgcggggtctgcaagtactgccgacgcggcagcgag
aacctctgtccggaatcccgctacaccggctgggacgccgacgggggatacgccgaattc
acgacggttcctgcggctttcgcgcaccatctgccgagcggctatagcgacagcgagctg
gcgccgttgttgtgcgccggcatcatcggatatcgatcgctgctgcgcaccgagctacca
cccggtggccggctgggtctctacggattcggcggcagtgcccacatcaccgcccaggtc
gcgttggcgcaaggcgccgaaatacatgtgatgacacgcggggcccgcgcgcgcaagctg
gcgctggaacttggcgccgcatcggctcaggacgccgccgaccggccacccgtgccgctg
gacgccgcgatcttattcgccccggtcggggatctggtgctgcccgcgctggaagcgctg
gaccgtggcggcatcttggcgatcgccgggatccacctgaccgatattccggacctgaac
taccagcggcacttgttccaggagcgtcagatccggtcggtcacgtcgaacacccgcgcc
gatgcgcgcgcgttcttcgacttcgccgcccagcatcacatcgaggtcaccacgccggaa
tacccgcttggccaagccgatcgtgcgctgggcgacctgagcgccggccgcatcgccggt
gccgccgtgctgctgatctga

DBGET integrated database retrieval system