KEGG   Mycobacterium canettii CIPT 140070017: BN45_50186Help
Entry
BN45_50186        CDS       T02422                                 

Gene name
aceA
Definition
(RefSeq) Isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN45_50186 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN45_50186 (aceA)
Enzymes [BR:mcz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BN45_50186 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2238604..2240904
Genome map
AA seq 766 aa AA seqDB search
MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQRGTIPVDHIVA
REAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSSTEDP
GPDLASYPLSQVPDDAAVLVRALLTADRNQHYLRLQMSERQRAATPAYDFRPFIIADADT
GHGGDPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQL
DIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFYELGV
KELNGHLLYALGDGEYAAAGGWLERQGIFGLVSDAVNAWREDGQQSIDGIFDQVESRFVA
AWEDDAGLMTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARVKAKELGADPP
WDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFP
DQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATAL
RQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQH
LVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQ
PIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSK
MKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccgaaacggacaccgaggtccacacaccgttcgagcaggactttgagaaa
gacgtagccgccactcagcgatacttcgacagctcgcgctttgctgggatcattcggctc
tacaccgcccgccaagttgtggaacagcgcggcacgatccccgtcgaccacatcgtggcg
cgagaggcggcgggcgccttctacgagcgtctgcgcgaactctttgctgcccgcaagagc
atcacaacgtttggcccctactcgccggggcaggcggtgagcatgaagcggatgggtatc
gaggcgatctacctcggtggttgggctacctcagctaagggctccagcaccgaagatccg
gggcccgacctcgccagctacccgctgagccaggtgcctgacgatgccgcggtgctggtg
cgcgccttgctcaccgcggaccgcaaccagcactatctacgcctgcagatgagcgagcga
cagcgtgcggcgacaccggcttacgacttccgcccgtttatcatcgccgacgccgacacc
ggccacggcggcgatccgcacgtacgcaacctgatccgccgcttcgtcgaggtcggtgtg
ccgggctaccacatcgaggaccaacgacccggcaccaagaagtgcggccaccagggcggc
aaggtcctggtgccgtccgacgaacagatcaagcggctcaacgccgcccgcttccagctc
gacatcatgcgggtgcccggcatcatcgtcgcacgcaccgacgccgaggcggccaacctg
atcgacagtcgcgccgacgagcgtgaccagccgttccttctcggcgcgaccaagctcgac
gtaccgtcctacaagtcctgtttcctggcaatggtgcggcgtttttacgaactgggcgtc
aaggagctcaatggtcatcttctctatgcgcttggcgacggcgagtacgcggcggccggc
ggttggcttgagcgccaaggcattttcggcttggtctccgacgcggtcaacgcgtggcgg
gaggacggccagcagtcgatcgacggcattttcgaccaggtcgagtcgcggttcgtggcg
gcctgggaggacgacgccggcctgatgacctacggagaggccgtggcggacgtgctcgaa
ttcggtcagagcgagggcgaacccattggcatggctcccgaggagtggcgggcgtttgcc
gcgcgtgcatcgctgcatgccgcccgggtaaaggccaaggagctgggcgccgatccgcca
tgggactgcgagctggccaagaccccggagggctactaccagatccgcggcggcataccg
tatgcgatcgccaaatcgctggccgcggcaccgtttgccgacattctttggatggagacc
aagaccgccgatctcgccgacgctcgacagttcgccgaggcgatccatgccgagttcccc
gaccagatgctggcgtacaacctctcaccatcgttcaactgggacaccaccggcatgacc
gacgaggagatgcggcgcttccccgaggagctcggcaaaatgggcttcgtcttcaacttc
atcacctatggcgggcaccagatcgacggtgtcgcggccgaggaattcgccaccgcgctg
cgccaggacggcatgctggcgctggctcggttgcagcgcaagatgcgcttggtcgaatct
ccctatcgcacaccgcaaacgctagtcggcgggccgcgcagtgacgccgcattggctgcc
tcctccggacgcacggcgaccacgaaggcaatgggcaagggctccacccagcaccagcac
ttggtgcaaactgaggtgccgcgcaagctgctagaggaatggctggccatgtggagcggt
cactaccagctcaaagacaaactgcgcgtacagcttcggccgcagcgggccggctcggag
gtgctcgagctcggcatccacggcgaaagcgatgacaaactcgccaacgtgatattccaa
ccgatccaagatcgccgcggccgcaccatcctgttggtacgcgaccagaacacgttcggt
gcggaactacgccaaaagcggctgatgaccctgatccacctctggctcgtccaccgcttc
aaggcgcaggcggtgcactacgtcacgcccaccgacgacaacctctaccagacctcgaag
atgaagtcgcatggaatcttcaccgaggtcaatcaggaggtgggcgagatcatcgtcgcc
gaggtgaaccacccgcgcatcgccgaactgctgacgcccgatcgggtggcgctgcggaaa
ttgatcacgaaggaggcgtag

DBGET integrated database retrieval system