KEGG   Mycobacterium canettii CIPT 140070017: BN45_50207Help
Entry
BN45_50207        CDS       T02422                                 

Gene name
echA
Definition
Putative enoyl-CoA hydratase EchA13 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN45_50207 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN45_50207 (echA)
   00650 Butanoate metabolism
    BN45_50207 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN45_50207 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN45_50207 (echA)
   00310 Lysine degradation
    BN45_50207 (echA)
   00360 Phenylalanine metabolism
    BN45_50207 (echA)
   00380 Tryptophan metabolism
    BN45_50207 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN45_50207 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN45_50207 (echA)
   00281 Geraniol degradation
    BN45_50207 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN45_50207 (echA)
   00627 Aminobenzoate degradation
    BN45_50207 (echA)
   00930 Caprolactam degradation
    BN45_50207 (echA)
Enzymes [BR:mcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN45_50207 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2266870..2267826)
Genome map
AA seq 318 aa AA seqDB search
MFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGATFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIDADEAHALGMVSKVFPVDELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRATPQIRPAIKQRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcggcagggtcggtccggtcgatcgccggtcggacggggaacgctcccgacgg
ccccgggagttcgaatacatccgctacgaaaccatcgacgatgggcgcatcgccgcgatc
accctggaccgcccgaaacaacgcaacgcccagacccgcggcatgctggtcgagctgggc
gccgccttcgaactggccgaggcggacgacaccgtccgggtggtgatcctgcgggccgcc
ggccccgccttctccgccggtcacgacctcggatccgctgacgatatccgggaacgctcg
cccgggccggaccagcaccccagctaccggtgcaacggggcgaccttcggcggggtcgag
tcacgcaaccgccaggagtggcactactacttcgaaaacaccaagcggtggcgcaacctg
cgcaagatcaccatcgcccaggtgcacggggccgtgctgtcggcggggttgatgctggcc
tggtgctgcgatctgatcgtcgccagcgaggacaccgtgttcgccgatgtggtcggcacc
cggctgggcatgtgcggggtcgagtacttcggacatccgtgggagttcgggccgcgcaag
accaaggaactgctgctcaccggcgactgcatagacgccgacgaggcccacgcgctgggg
atggtcagcaaggtgtttcccgttgacgaactcgccaccagcacaatcgaattcgcgcgt
cgaatcgcgaaggtaccgacgatggccgcactgctgatcaaggaatcggtgaaccaaacc
gtcgatgccatggggttttccgccgcactggacggttgcttcaagattcaccagctcaat
cacgcgcactggggcgaagtcaccggcggcaagctgtcctacggaacggtcgagtacgga
ctggaggattggcgtgccacaccgcagatccggcccgcgatcaagcagcggccctga

DBGET integrated database retrieval system