KEGG   Mycobacterium canettii CIPT 140070017: BN45_50542Help
Entry
BN45_50542        CDS       T02422                                 

Gene name
dlaT
Definition
(RefSeq) DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN45_50542 (dlaT)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN45_50542 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    BN45_50542 (dlaT)
Enzymes [BR:mcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN45_50542 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2574314..2575987
Genome map
AA seq 557 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVTRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGSELARIGVAADIGAAPAPKPAPEPAPKPVPEPAPTPKAEPAPSPPAAQPAG
AAEGAPYVTPLVRKLASENNIDLAEVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAA
AAPAPKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGL
RARAKAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVD
TEQGLLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFD
TPILVPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYLPLTYDHRLIDGADAGRFLT
TIKHRLEEGAFEADLGL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcccctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccaccgccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtcaccgaggggaccgtcactcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggctggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcagcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcacccgagcccgcacccaagcccgtccccgag
ccagcgccgacgccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggt
gcggccgagggcgcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaac
atcgacctcgccgaggtgaccggcaccggagtgggtggtcgcatccgtaaacaggatgtg
ctggccgcggctgagcaaaagaagcgggcgaaagcaccggcgccggccgcccaggccgcc
gccgcgccggctccgaaagcgccgcctgcccctgcgccggcgttggcgcatctacggggc
accacccagaaggccagccggattcgtcagatcaccgccaacaagacccgcgaatctttg
caggcaacggcacagctgacacaaacccatgaggtcgacatgaccaagatcgtggggcta
cgggcccgggccaaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccg
ttcttcgccaaggccgtgatcgatgccctcaagattcacccgaacatcaacgccagctac
aacgaggacaccaaggagatcacctactacgacgccgagcacctaggattcgctgtcgac
accgagcagggcctgctctccccggtcatccacgacgccggcgatctgtcactggccggt
ctggcgcgggcgatcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgac
gagttgtccggcggcaccttcaccatcaccaacatcggcagccagggcgcgttgttcgac
accccgatcctggttccaccgcaggccgccatgctgggcaccggggcgatcgtcaagcgg
ccgcgggtggtcgtcgatgccagcggtaacgagtcgatcggggtgcgctcggtctgctac
ctcccgttgacctatgaccatcggctcatcgacggcgccgatgccggacgtttcctcacc
acgatcaagcaccgcctcgaagagggagcgttcgaggccgatttaggactgtga

DBGET integrated database retrieval system