KEGG   Mycobacterium canettii CIPT 140070017: BN45_50878Help
Entry
BN45_50878        CDS       T02422                                 

Gene name
pdhC
Definition
Putative dihydrolipoamide S-acetyltransferase E2 component PdhC (lipoate acetyltransferase) (thioltransacetylase A) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN45_50878 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN45_50878 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BN45_50878 (pdhC)
   00620 Pyruvate metabolism
    BN45_50878 (pdhC)
Enzymes [BR:mcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN45_50878 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2915282..2916463)
Genome map
AA seq 393 aa AA seqDB search
MSGEDSIRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGR
IVELGGAEGDVLKVGAELVRIDTGPTAVAQPNGEGVVPTLVGYGADAAIETSRRTSRPLA
APVVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGIGAGPDVRPVHGVHARMAEK
MTLSHKEIPTAKASVEVVCAELLRLRDRFVSAAPEVTPFVLTLRLLVIALKHNIILNSTW
VDSAEGPQVHVHRGVHLGFGAATERGLLVPVITDAQDKNTRELASRVAELITGAREGTLT
PAELRGSTFTVSNFGALGVDDGVPVINYPEAAILGLGAIKPRPVVVGGEVVARPTMTLTC
VFDHRVVDGAQVAQFMCELRDLIESPETALLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaggacagcatcaggtctttcccggtgcccgacctcggcgagggactgcag
gaagtgacggtgacgtgctggagcgtcgccgtcggcgacgatgtggagatcaaccagacg
ctgtgttcggtggagaccgccaaggccgaggttgaaatccccagcccgtatgcaggccgg
atcgtcgagttaggcggcgccgaaggcgatgtgctcaaagtgggcgcggagctagttcgg
atcgacaccgggcccacggcagttgcgcagcctaacggtgagggagtggtcccgacgttg
gtcggctacggtgccgacgccgcgatcgaaaccagtagacggacaagccggccgctggcg
gcaccggtagtgcgcaagctggccaaagaattggcggtcgacctggccgcattgcagcgc
gggtcaggcgccggcggcgtgatcacccgggccgatgtgctggccgctgctcgaggtggc
atcggagccgggccagacgtgcgaccggtccacggcgtgcacgcgcggatggccgaaaaa
atgacgttgtcccacaaggagattccgaccgcaaaggccagcgttgaagtagtatgcgcc
gaactgctgcggctgcgcgaccggttcgtttcggcggcgcccgaggttacgccgttcgtg
ctgacgctgcggctgctggttattgcattgaaacacaacataattctcaactcgacgtgg
gtcgactcggccgaaggcccgcaagtacacgtgcatcgcggtgtgcatctggggttcggc
gcggccactgagcgtggattgctggtgccggtgatcaccgacgcccaggacaagaacacc
cgcgagcttgccagccgggtagcagaattgatcaccggcgcacgcgagggcactctcacg
cccgcggagctgcgcggttcgacgtttacggtgtcgaacttcggggcattgggagttgac
gacggcgtgccggtgatcaactatcccgaagcggcgattctgggtctgggggcgatcaag
ccgcgcccggtggtcgtcggcggcgaggttgtcgcacggccgacgatgacgctgacttgt
gtgttcgaccaccgcgttgtcgatggtgctcaggtagctcagttcatgtgtgagctgcgg
gatctgatcgagtcgccggagaccgcgctgttggatctgtag

DBGET integrated database retrieval system