KEGG   Mycobacterium canettii CIPT 140070017: BN45_50878Help
Entry
BN45_50878        CDS       T02422                                 

Gene name
pdhC
Definition
(GenBank) Putative dihydrolipoamide S-acetyltransferase E2 component PdhC (lipoate acetyltransferase) (thioltransacetylase A)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00010  Glycolysis / Gluconeogenesis
mcz00020  Citrate cycle (TCA cycle)
mcz00620  Pyruvate metabolism
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01120  Microbial metabolism in diverse environments
mcz01130  Biosynthesis of antibiotics
mcz01200  Carbon metabolism
Module
mcz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN45_50878 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BN45_50878 (pdhC)
   00620 Pyruvate metabolism
    BN45_50878 (pdhC)
Enzymes [BR:mcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN45_50878 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CCK64680
Position
complement(2915282..2916463)
Genome map
AA seq 393 aa AA seqDB search
MSGEDSIRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGR
IVELGGAEGDVLKVGAELVRIDTGPTAVAQPNGEGVVPTLVGYGADAAIETSRRTSRPLA
APVVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGIGAGPDVRPVHGVHARMAEK
MTLSHKEIPTAKASVEVVCAELLRLRDRFVSAAPEVTPFVLTLRLLVIALKHNIILNSTW
VDSAEGPQVHVHRGVHLGFGAATERGLLVPVITDAQDKNTRELASRVAELITGAREGTLT
PAELRGSTFTVSNFGALGVDDGVPVINYPEAAILGLGAIKPRPVVVGGEVVARPTMTLTC
VFDHRVVDGAQVAQFMCELRDLIESPETALLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaggacagcatcaggtctttcccggtgcccgacctcggcgagggactgcag
gaagtgacggtgacgtgctggagcgtcgccgtcggcgacgatgtggagatcaaccagacg
ctgtgttcggtggagaccgccaaggccgaggttgaaatccccagcccgtatgcaggccgg
atcgtcgagttaggcggcgccgaaggcgatgtgctcaaagtgggcgcggagctagttcgg
atcgacaccgggcccacggcagttgcgcagcctaacggtgagggagtggtcccgacgttg
gtcggctacggtgccgacgccgcgatcgaaaccagtagacggacaagccggccgctggcg
gcaccggtagtgcgcaagctggccaaagaattggcggtcgacctggccgcattgcagcgc
gggtcaggcgccggcggcgtgatcacccgggccgatgtgctggccgctgctcgaggtggc
atcggagccgggccagacgtgcgaccggtccacggcgtgcacgcgcggatggccgaaaaa
atgacgttgtcccacaaggagattccgaccgcaaaggccagcgttgaagtagtatgcgcc
gaactgctgcggctgcgcgaccggttcgtttcggcggcgcccgaggttacgccgttcgtg
ctgacgctgcggctgctggttattgcattgaaacacaacataattctcaactcgacgtgg
gtcgactcggccgaaggcccgcaagtacacgtgcatcgcggtgtgcatctggggttcggc
gcggccactgagcgtggattgctggtgccggtgatcaccgacgcccaggacaagaacacc
cgcgagcttgccagccgggtagcagaattgatcaccggcgcacgcgagggcactctcacg
cccgcggagctgcgcggttcgacgtttacggtgtcgaacttcggggcattgggagttgac
gacggcgtgccggtgatcaactatcccgaagcggcgattctgggtctgggggcgatcaag
ccgcgcccggtggtcgtcggcggcgaggttgtcgcacggccgacgatgacgctgacttgt
gtgttcgaccaccgcgttgtcgatggtgctcaggtagctcagttcatgtgtgagctgcgg
gatctgatcgagtcgccggagaccgcgctgttggatctgtag

DBGET integrated database retrieval system