KEGG   Mycobacterium canettii CIPT 140070017: BN45_50984Help
Entry
BN45_50984        CDS       T02422                                 

Gene name
ruvA
Definition
Putative holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mcz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3027117..3027707)
Genome map
AA seq 196 aa AA seqDB search
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLY
GFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGA
ERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDAT
TSSALRSALSLLGKAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcggtccgcggtgaggtgctcgaggtggcgcttgaccatgtggtgatcgag
gccgccggtgtgggctaccgagtgaacgcgacaccggcgacgctggcgacgttgcggcaa
ggcaccgaggcccggctgatcaccgcgatgattgtgcgcgaggactcgatgacgctgtac
gggtttcccgacggggaaacccgcgacctattcctgacgctgctgtcggtctccggcgtt
gggccccggctggcgatggcggcactggccgtgcacgacgctccggcgctacggcaggtg
ctggccgacggcaacgtcgccgccctgacccgggtgcccgggatcggcaagcggggcgcc
gaacgcatggtgttggaactacgcgacaaggttggggtggcagccaccggcggcgcactc
tcgaccaacggccacgcggtgcgcagtcccgtggtcgaggctctggtcggcctgggcttt
gcggccaaacaggccgaggaggccaccgatacggtgctggccgccaaccatgacgcgacg
acatccagcgcgctgcggtctgccttgtcgttgctggggaaggcccgatga

DBGET integrated database retrieval system