KEGG   Mycobacterium canettii CIPT 140070017: BN45_51121Help
Entry
BN45_51121        CDS       T02422                                 

Gene name
ephG
Definition
Epoxide hydrolase (EC:3.3.2.8)
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN45_51121 (ephG)
Enzymes [BR:mcz01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     BN45_51121 (ephG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3143191..3143631
Genome map
AA seq 146 aa AA seqDB search
MAELTETSPKAVEAIRAVEAFLNALQNEDFDTVDAALGDDLVYENVGFSRIRGGRRTATL
LRRMQGRIGFEVKIHRIGADGAAVLTERTDALIIGPLRVQFWVCGVFEVDDGRIILWRDY
FDVYDMLKGLLRGLVALVVPSLKATL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaccgaaacatcgccgaaagccgttgaggccattcgtgccgtcgaggcg
ttcctcaacgccctgcagaacgaagacttcgacaccgtcgacgccgcactgggcgacgac
ctggtctatgagaacgtcgggttttccaggatccgcggtggccgccgcacggcaacgctg
ttgcgccggatgcagggccgcatcggcttcgaggtgaagatccaccgcatcggcgccgac
ggcgccgcggtgctcaccgaacgcaccgacgcgctaatcatcggcccgctgcgggtgcag
ttctgggtctgcggcgtgttcgaggtggacgatgggcggatcatcctgtggcgggactac
ttcgatgtctacgacatgctcaagggcctcttgcgaggcctggtggcgctggtggtgcca
tcgctgaaggcaacgctgtag

DBGET integrated database retrieval system