KEGG   Mycobacterium canettii CIPT 140070017: BN45_51147Help
Entry
BN45_51147        CDS       T02422                                 

Gene name
dfrA
Definition
Dihydrofolate reductase DfrA (DHFR) (tetrahydrofolate dehydrogenase) (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mcz00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mcz00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3163075..3163554)
Genome map
AA seq 159 aa AA seqDB search
MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGR
RNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIGLP
REAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggtggggctgatctgggctcaagcgacatcgggtgtcatcggccgcggcggcgacatt
ccctggcgcttgcccgaggaccaggcgcatttccgggagatcaccatggggcacacgatc
gtgatgggccggcgcacctgggattcgctgccggctaaagtccggccgctgcccggccgg
cgaaatgtcgtactgagccgccaagctgactttatggccagcggggctgaggttgtcggt
tcactcgaggaggcgctgaccagcccggagacatgggtgatcggaggcggacaggtctat
gcgctggcgctgccgtacgcgaccagatgtgaggttaccgaggtcgacatcggcctgccg
cgcgaagccggtgacgcgctggcccccgtgctggacgagacatggcggggcgagacgggg
gagtggcgcttcagccggtccgggctgcggtaccggttgtacagctaccaccgctcatga

DBGET integrated database retrieval system