KEGG   Mycobacterium canettii CIPT 140070017: BN45_51246Help
Entry
BN45_51246        CDS       T02422                                 

Definition
Putative magnesium chelatase (EC:4.99.1.-)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mcz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3249569..3251455)
Genome map
AA seq 628 aa AA seqDB search
MKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSVATGSTE
TGLVELPLGATEDRVVGSLDLQRVMRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDI
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVQASRDIDV
RVQVIRRRMAYEADPDAFAARYADADAELAHRIAAARATVDDVVLGDNELRRIAALCAAF
DVDGMRADLVVARTAAAHAAWRGVRTVEEQDIRAAAELALPHRRRDPFDDHGIDRDQLDE
ALALASVDPEPEPDPPGGGQSANEPAAQPNSRSKSTKPGAPSSMGDDPPRPASPRLRSSP
RPSASPSTIFRTRALRVPGVGTGAPGRRSRARNASGSVVAAAEVSDPDAHGLHLFATLLA
AGERASGAGPLRPWADDVRRAIREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLRD
AYQRRDKVAVITFRQHEATLLLSPTSSAHIAGRRLARFSTGGKTPLAEGLLAARALIIRE
KVRDRARRPLVVVLTDGRATAGPDPLGRSRTAAAGLVAEGAAAVVVDCETSYVRLGLAAQ
LARQLGAPVVRLEQLHADYLVHAVRGVA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccttatccattcagcgcgatcgtcgggcacgatcggctgcggctcgcgttgttg
ttgtgtgccgtgcgaccggagatcggtggggcgctcatccgtggcgagaagggcacggcg
aaatcgacggcggtgcgcgggctggccgcgttgttgtcggtcgcgaccgggagcaccgag
accggcctcgtggagctgccgctgggggccaccgaagaccgggtggttggctcgctggat
ctgcagcgggtgatgcgcgacggcgagcacgcgttctctccgggactgctggctcgcgcc
cacggcggcgtgctctacgtcgacgaggtcaatctgctgcacgatcacctggttgacatc
ctgctcgacgccgccgccatgggacgggtacacgtcgaacgcgacggcatctcccattcc
cacgaggcccgtttcgtgctgatcggcacgatgaatccggaggagggcgaactgcgtccg
cagctgctggaccggttcgggctgaccgtcgacgtgcaggcgtcacgtgacatcgacgtg
cgggtacaggtcatccgccggcggatggcctacgaagccgacccggatgcgttcgccgca
cgctatgccgacgccgacgcggagctggcccaccggattgccgcggcccgcgccacggta
gacgatgtggtgttgggcgacaacgagttgcggcgcatcgctgcgttgtgcgcggcgttc
gacgtggacggcatgcgggccgatctggtagtggcccggacagccgccgcgcacgccgcc
tggcgtggtgttcgcaccgttgaagagcaggatatccgggcggcagcagaactggcgttg
ccgcatcgtcgtcgcgacccgttcgatgatcacggcatcgaccgcgaccagctggatgag
gcgctggcgctggcgagcgtcgacccagagcccgagcccgatccgcccgggggcggccag
tcagccaatgaacctgccgcacaaccgaactcacgctcgaagtcgacaaaacctggtgcg
ccgagctcgatgggcgacgacccgccgcgcccggcttcgccgcgcttgcgatcgtcgccg
cgcccgagcgcgtcgccgtcaacgatattccggacccgcgcgctgcgggtcccgggggtc
ggcacgggcgcgccggggcgacggtctcgggcccgcaacgcctcgggcagtgtggtggcg
gccgccgaggtcagcgaccccgacgcacatggactgcacctgttcgccaccctgctggcc
gccggcgagcgcgcgtccggagccgggccgttgcgcccgtgggcggacgatgtgcgccgg
gccatccgcgagggtcgcgaaggcaatctggtgatcttcgtcgtcgacgcttccggatcg
atggctgcgcgggaccggatggctgcggtcagtggcgccaccctgtcgctgctgcgcgac
gcctaccagcgcagggacaaggtggcggtgatcaccttccgccagcacgaggcaacgctg
ttgctgtcgccgacgtcgtcggcgcacatcgccggccggcgactggcccgattcagcacc
ggcggcaagaccccgctggctgagggactgctggccgcgcgtgcgctgatcatccgggag
aaggtgcgcgaccgcgcccggcgccccctggtggtcgtgctgaccgacggccgggccacc
gccgggccggacccgttgggccgcagccgaaccgcggctgccgggctggtcgccgagggc
gcggccgcggtggtggtggactgcgaaacgtcgtatgtacggctgggtttggcagcgcaa
ctggcccgtcagctgggtgcgccggtggttcggttggagcagttgcacgcggattatcta
gtgcatgccgtgcgtggcgtggcttga

DBGET integrated database retrieval system