KEGG   Mycobacterium canettii CIPT 140070017: BN45_60358Help
Entry
BN45_60358        CDS       T02422                                 

Gene name
sdhD
Definition
(GenBank) Putative succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD (Succinic dehydrogenase) (Fumarate reductase) (Fumarate dehydrogenase) (Fumaric hydrogenase)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00020  Citrate cycle (TCA cycle)
mcz00190  Oxidative phosphorylation
mcz00650  Butanoate metabolism
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01120  Microbial metabolism in diverse environments
mcz01130  Biosynthesis of antibiotics
mcz01200  Carbon metabolism
Module
mcz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN45_60358 (sdhD)
   00650 Butanoate metabolism
    BN45_60358 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BN45_60358 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CCK65535
Position
3822212..3822646
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRVDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcgtggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system