KEGG   Musca domestica (house fly): 101898667Help
Entry
101898667         CDS       T03448                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
mde  Musca domestica (house fly)
Brite
Enzymes [BR:mde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101898667
Peptidases [BR:mde01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101898667
Exosome [BR:mde04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101898667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 414 aa AA seqDB search
MYESYNFLNSLFRATIIPGLFVIVWLTGLISLVTVQICLLAFSLVFIVFPLVFRYSVTLQ
RGILFLTFITYPRDLDLSNPASVGLYATRSFHLNVPDADVEEDDAENKRYVRIGLWHVLP
KHVAKRFSKELQLSEEAQEDLQNITEVSDENLDKLEGAIKTSFPVVNPENQQLFYERLLK
VPGNTIVLYLHGNTASRGSGHRLDVYKLLRKLGYHVISFDYRGYGDSDPISPTEEGVVRD
AMAVYNYIRNLTSNPVFIWGHSLGTGVATNMLSQLNYLNDKGIKGVILEAPFTNIKDEIR
MHPFARPFKHLPWFDHTIARPMYLNSLRFESDQHISEFRQPIMILHAEDDYVVPFQLGYK
LYRIALDTRGKSWGPVEFHRFEGSRKYGHKYICYAPELPDLIQKFINNYYKDIF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaagctataattttctaaattcactttttcgcgccacaatcattcctggacta
tttgttatagtttggctaactgggttaatatctttagtgaccgtacaaatatgcctattg
gcattctcattagtattcatagtatttccactggtatttcgatattcagtaacgctacaa
agaggcatactatttttaacattcataacatatcccagagatctcgatttaagtaatcca
gcaagtgtgggcctctatgccacacggagttttcatctaaatgtacccgatgcagatgtg
gaggaagatgatgcggaaaataaacgttatgtacggattggcttgtggcatgttttgcca
aagcatgtggccaaacgatttagcaaggaattgcagctgagtgaggaagcccaagaagat
ctgcaaaacatcaccgaggtgtccgatgaaaatctggataaactggagggtgccataaaa
acatcattccccgtggtaaatcccgaaaatcaacagcttttctatgaacgcctgctaaag
gttccaggaaatacaattgtcttgtatctacatggcaatacagcatcgcgaggatcgggt
catcgtttggatgtttataagctactgcgaaagttgggttaccatgtcatatcattcgat
tatcgaggctatggcgattcagatcccatttcacccacagaagagggtgttgtgcgcgat
gcaatggccgtgtataattatatacgtaatttaacctcaaatccggtattcatatggggt
cattcgctgggcactggagttgcaacaaatatgctatcacagctgaattatctaaacgat
aagggtataaagggtgtgatattggaggcgccatttacaaatattaaggatgaaattcgc
atgcatccatttgccaggcccttcaaacatctgccatggttcgatcacaccattgcccgg
ccaatgtatttgaattcactgcgctttgaatcggatcaacacatcagtgaattccgtcaa
cccatcatgatattgcatgccgaagatgattatgttgtgccatttcaactgggctacaag
ctgtatcgcattgcattggatacgcgtggcaaatcttggggacccgtggaatttcatcgt
tttgaaggttcacggaaatatggccataaatatatttgctatgccccggaattacccgat
cttattcagaaatttatcaataactactacaaagatattttctaa

DBGET integrated database retrieval system