KEGG   Methylobacterium extorquens DM4: METDI0009Help
Entry
METDI0009         CDS       T00947                                 

Gene name
recD
Definition
Helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mdi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8968..11169
Genome map
AA seq 733 aa AA seqDB search
MNTSVRPGDLDGSTPLDMLAGSVERVTFHSAETGFCVLKVHARGRRDLVPVVGHAPAIAA
GEWLTASGRWVTDREHGLQFRADTLQVTPPTGIEGIERYLASGQMRGIGPMMAKRIVARF
GEAVFEIIEAEPARLTEVEGIGRKRAARIVKGWAEQKAVREIMIFLHAHGVGTARATRIF
RTYGGDSLKVMAEDPYRLARDIRGIGFRTADAIALRLGLARDAPQRLAAGVSYALQTAMD
EGHCGLPVERLVRLAAELLDVAPDLIRLAAALVLREGREVVADTLRGEPCLFLKGLHGAE
RVIAMQLAERAAGPPPWAAIDFALARPWVEAKTGKTLSASQAEAVGLVLRSKLCVLTGGP
GVGKTSTLDAILRILTAKGVRVLLAAPTGRAAKRMAEQTGLDARTLHRLLEIDPRNGGFQ
RNEDNPLDCDLLVIDETSMVDVPLMHALLKAVPERAGLILVGDVDQLPSVGPGQVLADVI
ASGTVPVARLTEIFRQAAQSRIVVNAHNINTGRMPAAPAKGEDSDFYLVEIEDADEGVET
LIELVTRRIPRRFGLNPTRDIQVLTPMIRGSLGSRNLNNALQRVLNPSPSAEVERFGWRF
APGDRVMETRNDYDRDVFNGDLGTISAIDAEDEALVVDFDGRAVIYPFNELDTLVPAFAT
TIHKAQGSEYPAVVIPVVTQHRTMLARNLLYTGVTRGRRLVVLIGQRRALAMAVREGASR
RRWTKLREWLDAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctcagtccgtcccggcgacctcgatggcagtacgcccctcgacatgctcgcc
ggctcggtcgagcgggtgacgttccacagcgccgagaccggcttctgcgtcctcaaggtc
catgcccgcggccggcgcgacctcgtaccggtggtgggtcacgcgcccgccatcgccgcg
ggcgagtggctgaccgcttccgggcgatgggtcaccgaccgtgagcacggcctccagttc
cgcgccgacacgcttcaggtgacaccgccgaccgggatcgagggcatcgagcgctacctc
gcctccgggcagatgcgcggcatcggcccgatgatggccaagcgcatcgtcgcccgcttc
ggggaggcggtgttcgagatcatcgaggccgagcccgcccgcctcaccgaggtcgagggg
atcggccgcaagcgcgccgcgcgcatcgtcaagggctgggccgagcagaaggccgtgcgg
gagatcatgatcttcctgcacgcccacggcgtcggcaccgcacgggcgacccggatcttc
cgcacctatggcggggattccttgaaggtcatggccgaggacccctatcggctcgcccgc
gacatccgcggcatcggcttccgcacggcggacgccattgccctgcgcctcggcctcgcc
cgcgacgcgccgcagcggctcgctgccggtgtctcctacgcgctccagacggcgatggat
gagggccattgcggcctgcccgtcgagcggctggtgcgtctcgccgccgagcttctcgac
gtcgcgcccgatctcatccggctcgccgcggcgctcgtcctgcgcgagggccgggaggtc
gtcgcggatacgctgcgcggcgagccctgcctgttcctcaagggcctgcacggcgccgag
cgcgtcatcgcgatgcagctggccgagcgcgccgccggcccgccaccctgggccgcgatc
gacttcgcgctggccaggccctgggtcgaggcgaagaccggaaagacgctgtccgcctcg
caggccgaggcggtcgggctggtgctccgctcgaagctctgcgttctcaccggcggcccc
ggcgtcggcaagaccagcaccctcgatgcgatcctgcgcatcctcaccgccaagggcgtg
cgggtgctgctcgccgcccccaccggccgcgcggccaagcgcatggccgagcagaccggg
ctggacgcacgcaccctccaccgcctgctggagatcgacccgcgcaacggcggctttcag
cgcaacgaggacaacccgctcgattgcgatctcctcgtcatcgacgagacctcgatggtc
gacgtgccgctgatgcatgcactgctcaaggcggtgccggagcgggcgggcctgatcctc
gtcggcgatgtcgatcagcttccgtcggtcggacccggacaggtgctggccgacgtgatt
gcctccggaaccgtgccggtggcgcgcctcaccgagatttttcgccaagcggcgcagagc
cggatcgtcgtcaatgcccacaacatcaacaccgggcggatgccggccgcgcccgccaag
ggcgaggacagcgacttctacctcgtcgagatcgaggacgcggacgagggcgtggagacg
ctgatcgaactcgtcacccgccgcatcccacgccgcttcggtcttaatcccacccgcgac
atccaagtgctgacgccgatgatccgcggctcgctcggcagccgcaacctcaacaacgcc
cttcagcgcgtcttgaatccgtcgccctcggcggaggtcgaacgcttcggctggcgcttt
gcgcccggcgaccgggtgatggagacccgcaacgactacgaccgcgacgtgttcaacggc
gacctcggcacgatcagcgccatcgatgcggaggacgaagcgctcgtggtcgatttcgac
ggtcgtgcggtgatctaccccttcaacgaactcgacacgctggtgccggccttcgccacg
acgatccacaaggcacagggctcggaatatccggccgtggtgatcccggtggtgacccag
caccgcacgatgctggcgcgcaacctgctctataccggcgtcacccgcgggcgccgcctc
gtcgtgctgatcggccagcgccgggcccttgcgatggcggtccgcgaaggcgcctcgcgg
cggcgctggaccaagctgcgggagtggctggacgccgcctga

DBGET integrated database retrieval system