KEGG   Methylobacterium extorquens DM4: METDI0054Help
Entry
METDI0054         CDS       T00947                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta protein (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    METDI0054 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    METDI0054 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    METDI0054 (trpB)
Enzymes [BR:mdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     METDI0054 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(53123..54364)
Genome map
AA seq 413 aa AA seqDB search
MTLNPAPNSFRTGPDERGRFGIFGGRFVAETLMPLILDLEKAYADAKADPSFKADMESYG
THYIGRPSPLYYAERLTEHLRAQAPAGQGAKIFFKREELNHTGSHKVNNVLGQILLARRM
GKPRIIAETGAGQHGVATATLCARFGLKCVVYMGAVDVERQAPNVFRMKMLGAEVIPVQS
GTRTLKDAMNEALRDWVTNVSDTFYCIGTVAGPHPYPAMVRDFQSVIGIETKQQMLEMEG
RLPDSLIACIGGGSNAMGLFHPFLDDRDVEIYGVEAAGHGVQSGLHAASLTGGRPGVLHG
NRTYLLMNEDGQIADAHSISAGLDYPGIGPEHAWLHEMGRVTYLSATDAETLEAFKLCSM
LEGIIPALEPAHALSKVMELAPTKPAEHLMVLNLSGRGDKDIPQVAQIFGQTL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaaccccgctcccaattccttccgcaccgggccggacgagcgcggtcgcttc
ggcatcttcggcggccgcttcgtggccgagacgctgatgccgctgattctcgatctcgag
aaggcctacgccgacgccaaggccgacccgtcgttcaaggcggatatggaatcctacggc
acccactacatcggccggccgagcccgctctactatgccgagcgcctgaccgagcacctg
cgcgcccaggctccggcggggcagggggcgaagatcttcttcaagcgcgaggagctgaac
cacaccggctcgcacaaggtgaacaacgtcctcggccagatcctgctcgcccgccgcatg
ggcaagccgcggatcatcgccgagaccggcgcgggccagcacggcgtcgcgaccgcgacg
ctctgcgcccgtttcggcctgaaatgcgtggtctacatgggcgccgtcgatgtcgagcgg
caggccccgaacgtgttccgcatgaagatgctcggcgccgaggtgatcccggtgcaatcc
ggcacgcgcacgctcaaggacgcgatgaacgaggcgctgcgcgactgggtcaccaacgtc
tcggacaccttctactgcatcggcaccgtggccggcccccatccctatccggcgatggtg
cgcgatttccaatcggtgatcggcatcgagacgaagcagcagatgctggagatggagggc
cgcctgccggattcgctcatcgcctgcatcggcggcggctcgaacgccatgggtctgttc
caccccttcctcgatgaccgcgacgtcgaaatctacggcgtcgaggcagccgggcacggc
gtgcagagcggcctccacgccgcctcgctcacgggcggccgcccgggcgtgctgcacggc
aaccggacctacctgctgatgaacgaggacggccagatcgccgacgcccactcgatctcg
gcgggcctcgattatcccgggatcggccccgaacacgcatggctgcacgagatgggccgg
gtcacctacctgtcggcgaccgatgccgagacgctggaggcgttcaagctctgctcgatg
ctagagggcatcatcccggctctggagcccgcgcacgcgctgtcgaaggtgatggagctc
gcgccgaccaagccggcggagcacctgatggtgctgaacctctctggccgcggcgacaag
gacatcccgcaggtggcgcagatcttcggtcagacgctctga

DBGET integrated database retrieval system